DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Ba and CG13670

DIOPT Version :10

Sequence 1:NP_647666.2 Gene:Cpr62Ba / 38239 FlyBaseID:FBgn0035279 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_648207.1 Gene:CG13670 / 38938 FlyBaseID:FBgn0035873 Length:266 Species:Drosophila melanogaster


Alignment Length:81 Identity:33/81 - (40%)
Similarity:42/81 - (51%) Gaps:4/81 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GPAGHIEFYSDYGRNHD-EERLHYSHQYHISDVASRVHILHREQRHGDYVSGSYSHLEPSGHIRS 86
            ||. |:....| ||..| ..|..||..|.:.|..:||....:|.|:||.|.|.||.::|.|.:|.
  Fly    82 GPE-HLVTVHD-GRTVDYVARPEYSFAYGVEDGKTRVLQNRKETRNGDEVRGVYSVVDPDGTLRV 144

  Fly    87 VHYEVRGANRGFKAVV 102
            |.|....|| ||:|.|
  Fly   145 VKYTADDAN-GFQAEV 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BaNP_647666.2 Chitin_bind_4 45..89 CDD:459790 18/43 (42%)
CG13670NP_648207.1 Chitin_bind_4 103..155 CDD:459790 21/52 (40%)

Return to query results.
Submit another query.