DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Ba and Cpr64Aa

DIOPT Version :10

Sequence 1:NP_647666.2 Gene:Cpr62Ba / 38239 FlyBaseID:FBgn0035279 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_647872.1 Gene:Cpr64Aa / 38508 FlyBaseID:FBgn0035510 Length:192 Species:Drosophila melanogaster


Alignment Length:92 Identity:28/92 - (30%)
Similarity:40/92 - (43%) Gaps:18/92 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 YSHQYHISDVASRVHILHREQRHGDYVSGSYSHLEPSGHIRSVHYEVRGANRGFKAVVEQRTGNS 109
            |:..|.:.|.::......:|.|.||.|.|:||.:|..|..|.|.|.....: ||.|||.      
  Fly    60 YTFSYDVHDGSTGDVKSQQETRSGDVVQGAYSLIEADGTRRIVEYTADPVH-GFNAVVR------ 117

  Fly   110 RVHQTLEFRSRQPIRALAIAEPVAFVI 136
                    |....::|:|   |||.|:
  Fly   118 --------REGAVVKAVA---PVAKVL 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BaNP_647666.2 Chitin_bind_4 45..89 CDD:459790 15/43 (35%)
Cpr64AaNP_647872.1 Chitin_bind_4 60..112 CDD:459790 16/52 (31%)

Return to query results.
Submit another query.