DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Ba and Cpr57A

DIOPT Version :10

Sequence 1:NP_647666.2 Gene:Cpr62Ba / 38239 FlyBaseID:FBgn0035279 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_611489.1 Gene:Cpr57A / 37319 FlyBaseID:FBgn0034517 Length:184 Species:Drosophila melanogaster


Alignment Length:134 Identity:27/134 - (20%)
Similarity:46/134 - (34%) Gaps:53/134 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FSFVVLCLLHIAHT---------------------QRGPA-GHIEFYSDYGRNHDEERLHYSHQY 49
            |..:|:|||.:|..                     |.|.| ||::      |.|.|         
  Fly     2 FIVLVVCLLAVAAADVSHLVTPEPKVPASPYVFSYQAGRAPGHVD------RQHTE--------- 51

  Fly    50 HISDVASRVHILHREQRHGDYVSGSYSHLEPSGHIRSVHYEVRGANRGFKAVVEQRTGNSRVHQT 114
             :||.:.             .:.|::|:::|...:|:|.|.  ....||...:..:..:|...|.
  Fly    52 -VSDGSG-------------VIRGAFSYVDPKNQVRTVQYV--ADEHGFHPQLSHKLEDSAAVQA 100

  Fly   115 LEFR 118
            .:.|
  Fly   101 AKQR 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BaNP_647666.2 Chitin_bind_4 45..89 CDD:459790 7/43 (16%)
Cpr57ANP_611489.1 Chitin_bind_4 32..84 CDD:459790 16/82 (20%)

Return to query results.
Submit another query.