DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Ba and Cpr56F

DIOPT Version :10

Sequence 1:NP_647666.2 Gene:Cpr62Ba / 38239 FlyBaseID:FBgn0035279 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_611470.1 Gene:Cpr56F / 37299 FlyBaseID:FBgn0034499 Length:217 Species:Drosophila melanogaster


Alignment Length:79 Identity:25/79 - (31%)
Similarity:35/79 - (44%) Gaps:7/79 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YGRNHDEER---LHYSHQYHISDVASRVHILHREQRHGDYVSGSYSHLEPSGHIRSVHYEVRGAN 95
            ||: .|||:   ..|..:|.:.|..|.....|.|.|.||...|.|..|.|.|..:.|.||  ...
  Fly   115 YGQ-RDEEQYGPAKYEFKYDVQDYESGNDFGHMESRDGDLAVGRYYVLLPDGRKQIVEYE--ADQ 176

  Fly    96 RGFKAVVE-QRTGN 108
            .|::..:. ::.||
  Fly   177 NGYRPTIRYEQVGN 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BaNP_647666.2 Chitin_bind_4 45..89 CDD:459790 15/43 (35%)
Cpr56FNP_611470.1 Chitin_bind_4 128..179 CDD:459790 17/52 (33%)

Return to query results.
Submit another query.