DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Ba and Cpr35B

DIOPT Version :10

Sequence 1:NP_647666.2 Gene:Cpr62Ba / 38239 FlyBaseID:FBgn0035279 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_609713.1 Gene:Cpr35B / 34846 FlyBaseID:FBgn0028871 Length:218 Species:Drosophila melanogaster


Alignment Length:126 Identity:34/126 - (26%)
Similarity:50/126 - (39%) Gaps:31/126 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FVVLCLLHIA---------HTQRGPAG--------HIEFYSD-----YGRNHD--------EERL 43
            |:...||.||         |...|..|        |:..:.|     :|.:||        :...
  Fly     6 FIAFALLAIAAIRAAPFHGHEHHGHHGGATSHASVHLTSHDDHHEEHHGHHHDHHGHDDHHDSHA 70

  Fly    44 HYSHQYHISDVASRVHILHREQRHGDYVSGSYSHLEPSGHIRSVHYEVRGANRGFKAVVEQ 104
            .|..||.:.|..:.......|.|||..|:|.|..::..||.|:||| ....::||:|.|.:
  Fly    71 EYDFQYGVKDQKTGDVKSQSESRHGHTVTGHYELIDADGHKRTVHY-TADKHKGFEAHVHR 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BaNP_647666.2 Chitin_bind_4 45..89 CDD:459790 15/43 (35%)
Cpr35BNP_609713.1 Chitin_bind_4 72..124 CDD:459790 17/52 (33%)

Return to query results.
Submit another query.