DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Ba and LOC3290077

DIOPT Version :10

Sequence 1:NP_647666.2 Gene:Cpr62Ba / 38239 FlyBaseID:FBgn0035279 Length:136 Species:Drosophila melanogaster
Sequence 2:XP_556644.2 Gene:LOC3290077 / 3290077 VectorBaseID:AGAMI1_006388 Length:168 Species:Anopheles gambiae


Alignment Length:72 Identity:26/72 - (36%)
Similarity:33/72 - (45%) Gaps:8/72 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 YSHQYHISDVASRVHILHREQRHGDYVSGSYSHLEPSGHIRSVHYEVRGANRGFKAVVE------ 103
            |..:|.:.|..:..|....|.|.||.|.|.|:..||.|..|.|.|.....| ||:|||:      
Mosquito    69 YKFEYGVKDYHTGDHKSQWEVRDGDVVKGEYTLDEPDGSTRIVKYHADSKN-GFEAVVKNIGKGG 132

  Fly   104 -QRTGNS 109
             |:.|.|
Mosquito   133 LQQEGGS 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BaNP_647666.2 Chitin_bind_4 45..89 CDD:459790 16/43 (37%)
LOC3290077XP_556644.2 None

Return to query results.
Submit another query.