DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Ba and Cpr31A

DIOPT Version :10

Sequence 1:NP_647666.2 Gene:Cpr62Ba / 38239 FlyBaseID:FBgn0035279 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_995678.1 Gene:Cpr31A / 2768918 FlyBaseID:FBgn0053302 Length:340 Species:Drosophila melanogaster


Alignment Length:98 Identity:34/98 - (34%)
Similarity:44/98 - (44%) Gaps:26/98 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RLHYSHQYHIS---DVASRVHILHREQRHGDYVSGSYSHLEPSGHIRSVHYEVRGANRGFKAVVE 103
            |..:|:..|.|   |:.|:|     |.|.|..|.||||.|:..|..|:|.|.....| ||.|||:
  Fly   134 RYDFSYGVHDSITGDIKSQV-----ETRDGGNVVGSYSVLDADGFKRTVTYTADDIN-GFNAVVQ 192

  Fly   104 QRTGNSRVHQTLEFRSRQP-IRALAIAEPVAFV 135
                            |:| :.|.|:|.||..|
  Fly   193 ----------------REPVVAARAVAAPVVSV 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BaNP_647666.2 Chitin_bind_4 45..89 CDD:459790 18/46 (39%)
Cpr31ANP_995678.1 Chitin_bind_4 135..187 CDD:459790 20/57 (35%)

Return to query results.
Submit another query.