DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Ba and LOC1281505

DIOPT Version :10

Sequence 1:NP_647666.2 Gene:Cpr62Ba / 38239 FlyBaseID:FBgn0035279 Length:136 Species:Drosophila melanogaster
Sequence 2:XP_321427.2 Gene:LOC1281505 / 1281505 VectorBaseID:AGAMI1_008591 Length:213 Species:Anopheles gambiae


Alignment Length:91 Identity:34/91 - (37%)
Similarity:41/91 - (45%) Gaps:19/91 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 YSHQYHISDVASRVHILHREQRHGDYVSGSYSHLEPSGHIRSVHYEVRGANRGFKAVVEQRTGNS 109
            ||..|.|||..:......:|.|.||.|.||||.::|.|..|:|.|.....| ||.|||.      
Mosquito    67 YSFSYGISDALTGDSKSQQESRSGDVVQGSYSVVDPDGTKRTVEYTADPHN-GFNAVVH------ 124

  Fly   110 RVHQTLEFRSRQPIRALAI--AEPVA 133
                      |:|:.|..|  |.|||
Mosquito   125 ----------REPLAAKTIVAAAPVA 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BaNP_647666.2 Chitin_bind_4 45..89 CDD:459790 19/43 (44%)
LOC1281505XP_321427.2 Chitin_bind_4 67..119 CDD:459790 21/52 (40%)

Return to query results.
Submit another query.