DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Ba and LOC1272964

DIOPT Version :10

Sequence 1:NP_647666.2 Gene:Cpr62Ba / 38239 FlyBaseID:FBgn0035279 Length:136 Species:Drosophila melanogaster
Sequence 2:XP_311895.4 Gene:LOC1272964 / 1272964 VectorBaseID:AGAMI1_008652 Length:200 Species:Anopheles gambiae


Alignment Length:113 Identity:37/113 - (32%)
Similarity:50/113 - (44%) Gaps:8/113 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 HIAHTQRGPAGHIEFYSDYGRNHDEERLHYSHQYHISDVASRVHILHREQRHGDYVSGSYSHLEP 80
            :::.||.......:.:.|...:.|.:|..||:.|.:.|..|......:|.|:||.|.|.|..||.
Mosquito    62 YVSRTQDQEQQQQQQHQDRRESSDYDRDDYSYGYAVRDELSGDIKSQQEVRNGDRVRGQYRTLES 126

  Fly    81 SGHIRSVHYEVRGANRGFKAVVEQR----TGNSRVHQTLE--FRSRQP 122
            .|..|.|.|..... |||.|||..:    |....|| ||:  ...|||
Mosquito   127 DGTERIVDYTADDV-RGFNAVVRHQPSVGTRAQLVH-TLQPAVLLRQP 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BaNP_647666.2 Chitin_bind_4 45..89 CDD:459790 17/43 (40%)
LOC1272964XP_311895.4 None

Return to query results.
Submit another query.