DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JTBR and jtr-1

DIOPT Version :9

Sequence 1:NP_001261289.1 Gene:JTBR / 38235 FlyBaseID:FBgn0025820 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001370785.1 Gene:jtr-1 / 176952 WormBaseID:WBGene00002180 Length:167 Species:Caenorhabditis elegans


Alignment Length:164 Identity:43/164 - (26%)
Similarity:69/164 - (42%) Gaps:22/164 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LENCQRHHMLLGLGALTMVTILVLFVESRYAADGPRRREPQ-----FVIEDNST----------- 50
            :|.|....:...:.||...:|||.|:| .|..:.....|.:     :..|...|           
 Worm     1 MEYCSTKQISTFVLALIGFSILVFFIE-EYTEESEMNSEMEMKKAFYKTEHGGTTGKLEKVVTEY 64

  Fly    51 ----CWRNEKYTMVQECHPCSEFDIVSRSLGVCIHTHYKEVLRC-QSGEIVTRSCDRVALIEQMN 110
                ||::|.:.:|.:|.||.:|:|.:...|.|:.|.|.:.:.| :|...|.|.|.......:..
 Worm    65 PAEECWKHEPFEVVTQCAPCKDFEIKAIKAGHCLKTGYFDRVNCSKSSTTVLRPCPSPKQSRRHE 129

  Fly   111 FLKFEVSCFVIGLLSYLVSYARDRVLSRRNYMRI 144
            |..|.|....|.::|:|.:..|...|.|..|||:
 Worm   130 FYLFYVVNAAILIVSFLSTTQRKAQLERAVYMRL 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JTBRNP_001261289.1 JTB 40..148 CDD:398872 33/126 (26%)
jtr-1NP_001370785.1 JTB 58..167 CDD:398872 30/106 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159399
Domainoid 1 1.000 55 1.000 Domainoid score I7410
eggNOG 1 0.900 - - E1_KOG4084
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 55 1.000 Inparanoid score I4062
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1375062at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto17531
orthoMCL 1 0.900 - - OOG6_108640
Panther 1 1.100 - - LDO PTHR13041
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5016
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.790

Return to query results.
Submit another query.