DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and SIS1

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_014391.1 Gene:SIS1 / 855725 SGDID:S000004952 Length:352 Species:Saccharomyces cerevisiae


Alignment Length:395 Identity:96/395 - (24%)
Similarity:159/395 - (40%) Gaps:98/395 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ELDYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPRQWAY 69
            |...|.:|.....|.::::...||:.|::.  |.||                   |.|:..::..
Yeast     4 ETKLYDLLGVSPSANEQELKKGYRKAALKY--HPDK-------------------PTGDTEKFKE 47

  Fly    70 VNMAFDVLGNDLYRAIYDRFG-EAGLFEGVMLPN------------GYFP--PYQYDGDH----- 114
            ::.||::|.:...|.|||::| ||....|   |:            |.||  ...:.|.|     
Yeast    48 ISEAFEILNDPQKREIYDQYGLEAARSGG---PSFGPGGPGGAGGAGGFPGGAGGFSGGHAFSNE 109

  Fly   115 --MKVYERVFGSYSPYANVID---AISNPPSLYATRQHGI----------------GVRSKDAS- 157
              ..::.:.||..||:....|   :.|:.||.......|:                |.||..:| 
Yeast   110 DAFNIFSQFFGGSSPFGGADDSGFSFSSYPSGGGAGMGGMPGGMGGMHGGMGGMPGGFRSASSSP 174

  Fly   158 ------TERI-IELSLEEVRTGCVKLMNVWRQEIVDAKESRLEKRKHTLKLNIAPGTTAGTRFCF 215
                  |.:: :.:|||::..|..|...:.|:....|.|      |..:.:.:.||..|||:..:
Yeast   175 TYPEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGASE------KTQIDIQLKPGWKAGTKITY 233

  Fly   216 KEEGDRYPATIPG---DIIFIAADKPHPDFERRNQHDLVYRQSIGLCQAFTGFTFFICTLDRRQL 277
            |.:||..|.|  |   .:.|:..:|.||:| :|:..||:|...:...::..||:..|.|:|.|.|
Yeast   234 KNQGDYNPQT--GRRKTLQFVIQEKSHPNF-KRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTL 295

  Fly   278 KVVITDVVQPGYTKVVPLEGLPKCRNLDAVTAIKEANKKVEQFGDLIIEFDYIFPKYLTPHMKHI 342
            .:.....|||..|...|.:|:|..:|             ..|.|:||:::...:|..|....|..
Yeast   296 PLSRVQPVQPSQTSTYPGQGMPTPKN-------------PSQRGNLIVKYKVDYPISLNDAQKRA 347

  Fly   343 TREFF 347
            ..|.|
Yeast   348 IDENF 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 95/393 (24%)
DnaJ 7..87 CDD:278647 16/79 (20%)
DnaJ_C 156..335 CDD:199909 51/189 (27%)
SIS1NP_014391.1 DnaJ 2..350 CDD:223560 94/391 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.