DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and YDJ1

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_014335.1 Gene:YDJ1 / 855661 SGDID:S000005008 Length:409 Species:Saccharomyces cerevisiae


Alignment Length:412 Identity:110/412 - (26%)
Similarity:165/412 - (40%) Gaps:127/412 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ELDYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPRQWAY 69
            |..:|.:|..|..||..:|..|||:.|::..|.::..:|      |.|             ::..
Yeast     4 ETKFYDILGVPVTATDVEIKKAYRKCALKYHPDKNPSEE------AAE-------------KFKE 49

  Fly    70 VNMAFDVLGNDLYRAIYDRFGEAGLFEGVMLPNGYFPPYQYD-GDHMKVYERVFGSYSPYANVID 133
            .:.|:::|.:...|.|||:|||.|| .|.....| ||...:. ||  .::.:.||:..       
Yeast    50 ASAAYEILSDPEKRDIYDQFGEDGL-SGAGGAGG-FPGGGFGFGD--DIFSQFFGAGG------- 103

  Fly   134 AISNPPSLYATRQHGIGVRSKDASTERIIELSLEEV------------------------RTGCV 174
                     |.|..| ..|.||...|  |..||||:                        :.|.|
Yeast   104 ---------AQRPRG-PQRGKDIKHE--ISASLEELYKGRTAKLALNKQILCKECEGRGGKKGAV 156

  Fly   175 K---------LMNVWRQ-------------------EIVDAKE-------SRLEKRKHTLKLNIA 204
            |         :..|.||                   :|:|.|:       .::|..:..|::::.
Yeast   157 KKCTSCNGQGIKFVTRQMGPMIQRFQTECDVCHGTGDIIDPKDRCKSCNGKKVENERKILEVHVE 221

  Fly   205 PGTTAGTRFCFKEEGDRYPATIPGDIIFIAADKPHPDFERRNQHDLVYRQSIGLCQAFTGFTFFI 269
            ||...|.|..||.|.|:.|..||||::||.:::||..| :|:..||||...|.|..|..|..|.:
Yeast   222 PGMKDGQRIVFKGEADQAPDVIPGDVVFIVSERPHKSF-KRDGDDLVYEAEIDLLTAIAGGEFAL 285

  Fly   270 CTLDRRQLKVVIT--DVVQPGYTKVVPLEGLPKCRNLDAVTAIKEANKKVEQFGDLIIEFDYIFP 332
            ..:....|||.|.  :|:.||..||:..:|:|              ..|...:|:|||:|...||
Yeast   286 EHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMP--------------IPKYGGYGNLIIKFTIKFP 336

  Fly   333 KYLTPHMKHITREFFREFRKLE 354
            :      .|.|.|  ...:|||
Yeast   337 E------NHFTSE--ENLKKLE 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 106/406 (26%)
DnaJ 7..87 CDD:278647 18/79 (23%)
DnaJ_C 156..335 CDD:199909 64/239 (27%)
YDJ1NP_014335.1 DnaJ 2..368 CDD:223560 110/412 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.