DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and APJ1

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_014322.1 Gene:APJ1 / 855647 SGDID:S000005021 Length:528 Species:Saccharomyces cerevisiae


Alignment Length:443 Identity:79/443 - (17%)
Similarity:147/443 - (33%) Gaps:148/443 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPRQWAYVNMA 73
            |..|:....|:..:|..|||..|::..|.::...|:                  ..|::..:..|
Yeast     8 YDSLNVTAAASTSEIKKAYRNAALKYHPDKNNHTEE------------------SKRKFQEICQA 54

  Fly    74 FDVLGNDLYRAIYDRFG-----------------EAGLF--------EGVMLP------------ 101
            :::|.::..||:||::|                 :||.|        |.:..|            
Yeast    55 YEILKDNRLRALYDQYGTTDEVLIQEQQAQAQRQQAGPFSSSSNFDTEAMSFPDLSPGDLFAQFF 119

  Fly   102 NGYFPP----------YQYDGDHMKVYERVFGS--YSPYANVIDAISNPPSLYATR----QHGIG 150
            |....|          :.::......:..|.||  .:.|::.....||....:..|    :|.:.
Yeast   120 NSSATPSSNGSKSSFNFSFNNSSTPSFSFVNGSGVNNLYSSSAKYNSNDEDHHLDRGPDIKHNLK 184

  Fly   151 VRSKDASTERIIELSLEEVRT-------GCVK---------------------LMNVWRQEIVDA 187
            ...|:....:..:|.|...|.       |.:|                     |:..|.|...|.
Yeast   185 CTLKELYMGKTAKLGLNRTRICSVCDGHGGLKKCTCKTCKGQGIQTQTRRMGPLVQSWSQTCADC 249

  Fly   188 KESRL----------------EKRKHTLKLNIAPGTTAGTRFCFKEEGDRYPAT--------IPG 228
            ..:.:                .|.:..|::.:.||:..........|||...:|        |||
Yeast   250 GGAGVFVKNKDICQQCQGLGFIKERKILQVTVQPGSCHNQLIVLTGEGDEVISTKGGGHEKVIPG 314

  Fly   229 DIIFIAADKPHPDFERRNQHDLVYRQ-SIGLCQAFTGFTFFI--------CTLDRRQLKVVITDV 284
            |::........|:|:..|..:|:.:: .|....:..|...:|        ..||     ::..::
Yeast   315 DVVITILRLKDPNFQVINYSNLICKKCKIDFMTSLCGGVVYIEGHPSGKLIKLD-----IIPGEI 374

  Fly   285 VQPGYTKVVPLEGLPKCRNLDAVTAIKEANKKVEQFGDLIIEFDYIFPKYLTP 337
            ::||..|.|...|:||     .:..::..      ||.|.::||..:|:.|.|
Yeast   375 LKPGCFKTVEDMGMPK-----FINGVRSG------FGHLYVKFDVTYPERLEP 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 79/443 (18%)
DnaJ 7..87 CDD:278647 15/77 (19%)
DnaJ_C 156..335 CDD:199909 43/239 (18%)
APJ1NP_014322.1 DnaJ 2..427 CDD:223560 79/443 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.