DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and JJJ2

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_012373.2 Gene:JJJ2 / 853277 SGDID:S000003698 Length:583 Species:Saccharomyces cerevisiae


Alignment Length:170 Identity:34/170 - (20%)
Similarity:57/170 - (33%) Gaps:50/170 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PELD---YYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPR 65
            |:||   ||::|.....||..::..:|.:||..|.|.:.|.|:.:.:..|    :.|        
Yeast     7 PQLDRTTYYSILGLTSNATSSEVHKSYLKLARLLHPDKTKSDKSEELFKA----VVH-------- 59

  Fly    66 QWAYVNMAFDVLGNDLYRAIYDRFGEAGLFEGVMLPNGYFPPYQYDGDH----------MKVYER 120
                   |..:|.::..:..|||                  ..:..|.|          .|...:
Yeast    60 -------AHSILTDEDQKLRYDR------------------DLKIKGLHTYQPKKNCHIFKTKAK 99

  Fly   121 VFGSYSPYANVIDAISNPPSLYATRQHGIGVRSKDASTER 160
            .....||.....:|.......|..:.:|.||..|..|:.:
Yeast   100 ESQGASPTLGQSEAYHRQNKPYEQQPYGFGVGKKMTSSSK 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 32/167 (19%)
DnaJ 7..87 CDD:278647 17/82 (21%)
DnaJ_C 156..335 CDD:199909 1/5 (20%)
JJJ2NP_012373.2 DnaJ 13..74 CDD:395170 16/79 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.