DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and AT1G59725

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_176181.1 Gene:AT1G59725 / 842265 AraportID:AT1G59725 Length:331 Species:Arabidopsis thaliana


Alignment Length:354 Identity:101/354 - (28%)
Similarity:163/354 - (46%) Gaps:54/354 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LDYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPRQWAYV 70
            :|||.||:....||::.:..:|||||::.  |.||..    ..:.||..          .::..:
plant     3 VDYYNVLNVNPSATEDDLKKSYRRLAMKW--HPDKNP----TSIKQEAE----------AKFKQI 51

  Fly    71 NMAFDVLGNDLYRAIYDRFGEAGLFEGVMLP------------NGYFPPYQ-YDGDHMKVYERVF 122
            :.|:|||.:...|.|||::||.||.......            |.|...:: |..|...::...|
plant    52 SEAYDVLSDPNKRQIYDQYGEDGLTATEATASSQQHNYSSGNNNNYNAGFRYYPRDAEDIFAEFF 116

  Fly   123 GSYSPYANVIDAISNPPSLYATRQHG------IGVRSKDASTERIIELSLEEVRTGCVKLMNVWR 181
            |:..   .|.|........:.:.:.|      ..|..|..:.|..:..:|||:..|..:.|.:.|
plant   117 GASE---KVFDGGVGGGGRFKSAEAGSQTNRKTPVNRKAPAIESKLACTLEELYKGGRRKMKISR 178

  Fly   182 QEIVDAKESRLEKRKHTLKLNIAPGTTAGTRFCFKEEGDRYPATIPGDIIFIAADKPHPDFERRN 246
              :|.....:.:..:..||::|.||...||:..|.|:|::.|...|.|:||:..:|||..: :|:
plant   179 --VVPDGLGKSKPVEEILKIDITPGWKKGTKITFPEKGNQEPGVTPADLIFVIDEKPHSVY-KRD 240

  Fly   247 QHDLVYRQSIGLCQAFTGFTFFICTLDRRQLKVVITDVVQPGYTKVVPLEGLPKCRNLDAVTAIK 311
            .:||:..:.:.|.:|.||.|..:.|||.|.|.:.:.|:|:||...|:|.||:|         ..|
plant   241 GNDLIVDKKVSLLEALTGITLSLTTLDGRNLTIPVLDIVKPGQEIVIPSEGMP---------ISK 296

  Fly   312 EANKKVEQFGDLIIEFDYIFPKYLTPHMK 340
            |.:|:    |||.|.|:..||..||...|
plant   297 EGSKR----GDLRINFEICFPSRLTSEQK 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 101/353 (29%)
DnaJ 7..87 CDD:278647 23/79 (29%)
DnaJ_C 156..335 CDD:199909 58/178 (33%)
AT1G59725NP_176181.1 DnaJ 1..325 CDD:223560 101/354 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 1 1.010 - - D1393097at2759
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.790

Return to query results.
Submit another query.