DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and AT1G44160

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_175080.2 Gene:AT1G44160 / 841019 AraportID:AT1G44160 Length:357 Species:Arabidopsis thaliana


Alignment Length:202 Identity:58/202 - (28%)
Similarity:99/202 - (49%) Gaps:19/202 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 PSLYATRQHGIGVRSKDASTERIIELSLEEVRTGCVKLMNVWRQEIVDAKESRLEKRKHTLKLNI 203
            |.||::....:   :|.:.||:.:..:|||:..||.|.:.:.|..|....|...|  :..:::.:
plant   164 PILYSSSSAKV---AKPSPTEKKLRCTLEELCNGCTKKIKIKRDVITSLGEKCEE--EEMVEIKV 223

  Fly   204 APGTTAGTRFCFKEEGDRYPATIPGDIIFIAADKPHPDFERRNQHDLVYRQSIGLCQAFTGFTFF 268
            .||...||:..|:.:|:....::|.|:.|:..:|.|..|:|... ||.....:.|.:|.||....
plant   224 KPGWKGGTKVTFEGKGNEAMRSVPADLTFVIVEKEHEVFKREGD-DLEMAVEVSLLEALTGCELS 287

  Fly   269 ICTLDRRQLKVVITDVVQPGYTKVVPLEGLPKCRNLDAVTAIKEANKKVEQFGDLIIEFDYIFPK 333
            :..||...:::.|.||:.|||..||..:|:|.         :||..|:    |||.:.|...||:
plant   288 VALLDGDNMRLRIEDVIHPGYVTVVQGKGMPN---------LKEKGKR----GDLRVRFRTKFPQ 339

  Fly   334 YLTPHMK 340
            :||...:
plant   340 HLTDEQR 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 58/202 (29%)
DnaJ 7..87 CDD:278647
DnaJ_C 156..335 CDD:199909 52/178 (29%)
AT1G44160NP_175080.2 DnaJ_C 178..341 CDD:199909 52/178 (29%)
DnaJ <221..357 CDD:223560 42/140 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1393097at2759
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.