DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and AT5G01390

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_195759.1 Gene:AT5G01390 / 831415 AraportID:AT5G01390 Length:335 Species:Arabidopsis thaliana


Alignment Length:361 Identity:108/361 - (29%)
Similarity:168/361 - (46%) Gaps:63/361 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LDYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPRQWAYV 70
            :|:|.||:..|.|..:::..|||:||::..|.::..::::     .|.:...:|.          
plant     3 VDFYKVLEVDRSANDDELKKAYRKLAMKWHPDKNPNNKKE-----AEAKFKQISE---------- 52

  Fly    71 NMAFDVLGNDLYRAIYDRFGEAGLFE------GVMLPNG-------YFPPYQYDGDHMKVYERVF 122
              |:|||.:...||||:::||.||.:      |...|.|       .|.|...|    .::...|
plant    53 --AYDVLSDPQKRAIYEQYGEEGLNQAPPPGAGGGYPGGSDAGASFRFNPRSAD----DIFSEFF 111

  Fly   123 GSYSP-YANVIDAISNPPSL-----------YATRQHGIGVRS-KDASTERIIELSLEEVRTGCV 174
            |...| :....|:.:.|...           .||......:.| |.|..||.:..|||::..|..
plant   112 GFTRPSFGTGSDSRAGPSGFRYGDDIFASFRAATTGGEASIPSRKSAPIERQLPCSLEDLYKGVS 176

  Fly   175 KLMNVWRQEIVDAKESRLEKRKHTLKLNIAPGTTAGTRFCFKEEGDRYPATIPGDIIFIAADKPH 239
            |.|.:.| :::|: ..|....:..|.:.|.||...||:..|.|:|:.:...||.|::||..:|||
plant   177 KKMKISR-DVLDS-SGRPTPVEEILTIEIKPGWKKGTKITFLEKGNEHRGVIPSDLVFIVDEKPH 239

  Fly   240 PDFERRNQHDLVYRQSIGLCQAFTGFTFFICTLDRRQLKVVITDVVQPGYTKVVPLEGLPKCRNL 304
            |.| :|:.:|||..|.|.|..|.||:|..:.|||.|.|.|.:.:|:.|.|.:||..||:|     
plant   240 PVF-KRDGNDLVVMQKISLVDALTGYTAQVTTLDGRTLTVPVNNVISPSYEEVVKGEGMP----- 298

  Fly   305 DAVTAIKEANKKVEQFGDLIIEFDYIFPKYLTPHMK 340
                ..|:.::|    |:|.|.|...||..||...|
plant   299 ----IPKDPSRK----GNLRIRFIIKFPSKLTTEQK 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 108/360 (30%)
DnaJ 7..87 CDD:278647 21/79 (27%)
DnaJ_C 156..335 CDD:199909 64/178 (36%)
AT5G01390NP_195759.1 DnaJ 1..326 CDD:223560 107/359 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 1 1.010 - - D1393097at2759
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.790

Return to query results.
Submit another query.