DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and AT4G28480

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_194577.1 Gene:AT4G28480 / 828965 AraportID:AT4G28480 Length:348 Species:Arabidopsis thaliana


Alignment Length:384 Identity:115/384 - (29%)
Similarity:169/384 - (44%) Gaps:76/384 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LDYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPRQWAYV 70
            :|||.||...|.|..:.:..|||:||::..|.::..:::|     .|.:...:|.          
plant     3 VDYYKVLQVDRSANDDDLKKAYRKLAMKWHPDKNPNNKKD-----AEAKFKQISE---------- 52

  Fly    71 NMAFDVLGNDLYRAIYDRFGEAGLFEGVMLPNGYFPPYQY----DGDHM---------KVYERVF 122
              |:|||.:...||:||::||.||...|..||.......|    ||...         .::...|
plant    53 --AYDVLSDPQKRAVYDQYGEEGLKGNVPPPNAATSGASYFSTGDGSSSFRFNPRSADDIFAEFF 115

  Fly   123 GSYSPYANVIDAISNP--------PSLYATRQHGIG---------------VRSKDASTERIIEL 164
            |..:|:..........        ..:||:...|.|               ...|.|..|..:..
plant   116 GFSTPFGGGGGGTGGQRFASRMFGDDMYASFGEGAGGGGAMHHHHHHHHHAAARKVAPIENKLPC 180

  Fly   165 SLEEVRTGCVKLMNVWRQEIVDAKESRLEKRKHTLKLNIAPGTTAGTRFCFKEEGDRYPATIPGD 229
            |||::..|..|.|.:.| ||||.....::. :..|.:.:.||...||:..|.|:|:.:|..||.|
plant   181 SLEDLYKGTTKKMKISR-EIVDVSGKAMQV-EEILTIGVKPGWKKGTKITFPEKGNEHPGVIPAD 243

  Fly   230 IIFIAADKPHPDFERRNQHDLVYRQSIGLCQAFTGFTFFICTLDRRQLKVVITDVVQPGYTKVVP 294
            ::||..:||||.|.|.. :||:..|.:.|..|.||:|..|.|||.|.|.:.||:|:.|.|.:|||
plant   244 LVFIIDEKPHPVFTREG-NDLIVTQKVSLADALTGYTANIATLDGRTLTIPITNVIHPEYEEVVP 307

  Fly   295 LEGLPKCRNLDAVTAIKEANKKVEQFGDLIIEFDYIFPKYLTPHMKHITREFFREFRKL 353
            .||:|         ..|:..||    |:|.|:|:..||..||...|       ..|:||
plant   308 KEGMP---------LQKDQTKK----GNLRIKFNIKFPARLTAEQK-------AGFKKL 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 113/380 (30%)
DnaJ 7..87 CDD:278647 22/79 (28%)
DnaJ_C 156..335 CDD:199909 67/178 (38%)
AT4G28480NP_194577.1 DnaJ 1..346 CDD:223560 113/382 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 1 1.010 - - D1393097at2759
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.790

Return to query results.
Submit another query.