DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and AT3G47940

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_190377.1 Gene:AT3G47940 / 823949 AraportID:AT3G47940 Length:350 Species:Arabidopsis thaliana


Alignment Length:393 Identity:105/393 - (26%)
Similarity:163/393 - (41%) Gaps:114/393 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LDYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPRQWAYV 70
            :|||.:|.....||::.:..||:|||:...|.::....:|    ..|.:...:|.          
plant     3 VDYYNILKVNHNATEDDLKKAYKRLAMIWHPDKNPSTRRD----EAEAKFKRISE---------- 53

  Fly    71 NMAFDVLGNDLYRAIYDRFGEAGLFEGVMLPNG-----------------YF-------PP---- 107
              |:|||.:...|.|||.:||.||..| .:||.                 :|       ||    
plant    54 --AYDVLSDPQKRQIYDLYGEEGLKSG-KIPNSSSSEASSSSSSSSSRYPHFHQHRPQHPPNASS 115

  Fly   108 YQYD-GDHMKVYERVFGS-----------------------------YSPYANVIDAISNPPSLY 142
            :::: .|...:|...|||                             ||.....:.|:.||    
plant   116 FRFNPRDAEDIYAEFFGSENGGGSNNAGGRGNRAFRNGHFNTGGANGYSGEMRKVPAMENP---- 176

  Fly   143 ATRQHGIGVRSKDASTERIIELSLEEVRTGCVKLMNVWRQEIVDAKESRLEKRKHTLKLNIAPGT 207
                               :.:|||::..|.||.|.:.| .:.|| ..|:......|.:.|.||.
plant   177 -------------------LPVSLEDLYKGVVKKMRITR-NVYDA-SGRMMVEAEILPIEIKPGW 220

  Fly   208 TAGTRFCFKEEGDRYPATIPGDIIFIAADKPHPDFERRNQHDLVYRQSIGLCQAFTGFTFFICTL 272
            ..||:..|.::|:..|..||.||:|:..:||||.: :|:.:||:..|.|.|.:|.||.|..:.||
plant   221 KKGTKLTFPKKGNEEPGIIPADIVFVVEEKPHPVY-KRDGNDLLVSQEITLLEALTGKTVNLITL 284

  Fly   273 DRRQLKVVITDVVQPGYTKVVPLEGLPKCRNLDAVTAIKEANKKVEQFGDLIIEFDYIFPKYLTP 337
            |.|.|.:.:|::::|.:..|||.||:|         ..||..||    |:|.::....:|..||.
plant   285 DGRTLMIPLTEIIKPDHEIVVPNEGMP---------ISKEPGKK----GNLKLKLSVKYPSRLTS 336

  Fly   338 HMK 340
            ..|
plant   337 DQK 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 105/392 (27%)
DnaJ 7..87 CDD:278647 21/79 (27%)
DnaJ_C 156..335 CDD:199909 59/178 (33%)
AT3G47940NP_190377.1 DnaJ 1..344 CDD:223560 105/393 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 1 1.010 - - D1393097at2759
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.790

Return to query results.
Submit another query.