DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and AT3G08910

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_187503.1 Gene:AT3G08910 / 820040 AraportID:AT3G08910 Length:323 Species:Arabidopsis thaliana


Alignment Length:364 Identity:109/364 - (29%)
Similarity:167/364 - (45%) Gaps:68/364 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LDYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPRQWAYV 70
            :|||.||...|.|..:.:..|||:||::..|.::..:::|     .|.:...:|.          
plant     3 VDYYKVLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKD-----AEAKFKQISE---------- 52

  Fly    71 NMAFDVLGNDLYRAIYDRFGEAGLFEGVMLP--NGYF----PPYQYDGDHM-KVYERVFGSYSPY 128
              |:|||.:...|||||::||.||......|  .|.|    ..::::|... .::...||...|:
plant    53 --AYDVLSDPQKRAIYDQYGEEGLTSQAPPPGAGGGFSDGGASFRFNGRSADDIFSEFFGFTRPF 115

  Fly   129 AN------------VIDAISN---PPSLYATRQHGIGVRSKDASTERIIELSLEEVRTGCVKLMN 178
            .:            ..|..|:   ||             .|.|..||.:..|||::..|..|.|.
plant   116 GDSRGAGPSNGFRFAEDVFSSNVVPP-------------RKAAPIERQLPCSLEDLYKGVSKKMK 167

  Fly   179 VWRQEIVDAKESRLEKRKHTLKLNIAPGTTAGTRFCFKEEGDRYPATIPGDIIFIAADKPHPDFE 243
            :.| :::|: ..|....:..|.:.|.||...||:..|.|:|:.....||.|::||..:|||..| 
plant   168 ISR-DVLDS-SGRPTTVEEILTIEIKPGWKKGTKITFPEKGNEQRGIIPSDLVFIVDEKPHAVF- 229

  Fly   244 RRNQHDLVYRQSIGLCQAFTGFTFFICTLDRRQLKVVITDVVQPGYTKVVPLEGLPKCRNLDAVT 308
            :|:.:|||..|.|.|.:|.||:|..:.|||.|.:.|.|.:|:.|.|.:||..||:|         
plant   230 KRDGNDLVMTQKIPLVEALTGYTAQVSTLDGRSVTVPINNVISPSYEEVVKGEGMP--------- 285

  Fly   309 AIKEANKKVEQFGDLIIEFDYIFPKYLTPHMKHITREFF 347
            ..|:.:||    |:|.|:|...||..||...|...:..|
plant   286 IPKDPSKK----GNLRIKFTVKFPSRLTTEQKSGIKRMF 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 109/363 (30%)
DnaJ 7..87 CDD:278647 23/79 (29%)
DnaJ_C 156..335 CDD:199909 64/178 (36%)
AT3G08910NP_187503.1 DnaJ 1..313 CDD:223560 107/355 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 1 1.010 - - D1393097at2759
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.790

Return to query results.
Submit another query.