Sequence 1: | NP_647662.1 | Gene: | CG12020 / 38233 | FlyBaseID: | FBgn0035273 | Length: | 366 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001026893.1 | Gene: | DNAJB14 / 79982 | HGNCID: | 25881 | Length: | 379 | Species: | Homo sapiens |
Alignment Length: | 282 | Identity: | 62/282 - (21%) |
---|---|---|---|
Similarity: | 95/282 - (33%) | Gaps: | 111/282 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 DYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPRQWAYVN 71
Fly 72 MAFDVLGNDLYRAIYDRFG--------------------EA--------GLFEGVMLPN------ 102
Fly 103 -----GYFPPYQY-DGDHMKVYERVFGSYSPYANVIDAI-------------SNPP-SLYATRQH 147
Fly 148 GIGVR------------SKDASTE------RIIELSLEE-----VRTGCVKLMNVW--RQEIVDA 187
Fly 188 -------KESRLEKRKHTLKLN 202 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12020 | NP_647662.1 | DnaJ | 7..352 | CDD:223560 | 62/282 (22%) |
DnaJ | 7..87 | CDD:278647 | 21/79 (27%) | ||
DnaJ_C | 156..335 | CDD:199909 | 14/67 (21%) | ||
DNAJB14 | NP_001026893.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 55..94 | ||
DnaJ | 107..>214 | CDD:223560 | 29/124 (23%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 219..241 | 4/21 (19%) | |||
DUF1977 | 271..371 | CDD:370429 | 24/100 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |