DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and DNAJB14

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001026893.1 Gene:DNAJB14 / 79982 HGNCID:25881 Length:379 Species:Homo sapiens


Alignment Length:282 Identity:62/282 - (21%)
Similarity:95/282 - (33%) Gaps:111/282 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPRQWAYVN 71
            :||.||...:.|..|.:..|||:||::.  |.||..                :| |....:..:.
Human   108 NYYEVLGVTKDAGDEDLKKAYRKLALKF--HPDKNH----------------AP-GATDAFKKIG 153

  Fly    72 MAFDVLGNDLYRAIYDRFG--------------------EA--------GLFEGVMLPN------ 102
            .|:.||.|...|..||..|                    ||        .:|.|...|:      
Human   154 NAYAVLSNPEKRKQYDLTGNEEQACNHQNNGRFNFHRGCEADITPEDLFNIFFGGGFPSGSVHSF 218

  Fly   103 -----GYFPPYQY-DGDHMKVYERVFGSYSPYANVIDAI-------------SNPP-SLYATRQH 147
                 ||...:|: ...|.:..||..|.:|.:..::..|             |||| |||.....
Human   219 SNGRAGYSQQHQHRHSGHEREEERGDGGFSVFIQLMPIIVLILVSLLSQLMVSNPPYSLYPRSGT 283

  Fly   148 GIGVR------------SKDASTE------RIIELSLEE-----VRTGCVKLMNVW--RQEIVDA 187
            |..::            :||...|      :.:|.|:||     :|..|      |  ||:..|.
Human   284 GQTIKMQTENLGVVYYVNKDFKNEYKGMLLQKVEKSVEEDYVTNIRNNC------WKERQQKTDM 342

  Fly   188 -------KESRLEKRKHTLKLN 202
                   ::.||.::...|.::
Human   343 QYAAKVYRDDRLRRKADALSMD 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 62/282 (22%)
DnaJ 7..87 CDD:278647 21/79 (27%)
DnaJ_C 156..335 CDD:199909 14/67 (21%)
DNAJB14NP_001026893.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 55..94
DnaJ 107..>214 CDD:223560 29/124 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..241 4/21 (19%)
DUF1977 271..371 CDD:370429 24/100 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.