DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and Dnajc21

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_084322.2 Gene:Dnajc21 / 78244 MGIID:1925371 Length:531 Species:Mus musculus


Alignment Length:382 Identity:85/382 - (22%)
Similarity:142/382 - (37%) Gaps:115/382 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPRQWAYVNM 72
            :|..|...|.|::|::..|||:||:|.  |.||             .|.:.:...|  |:..:..
Mouse     4 HYEALGVRRDASEEELKKAYRKLALRW--HPDK-------------NLDNAAEAAE--QFKLIQA 51

  Fly    73 AFDVLGNDLYRAIYDRFGEAGLFEGVMLPNGYFPPYQYDGDHMKVY------------ERVFGSY 125
            |:|||.:...||.||...||      :|..|....||.|...:..|            ||  |.|
Mouse    52 AYDVLSDPQERAWYDNHREA------LLKGGLDGEYQDDSLDLLHYFTVTCYSGYGDDER--GFY 108

  Fly   126 SPYANVIDAISNPPSLYATRQHGI------GVRSKDASTERIIELSLEEVRTGCVKLMNVWRQEI 184
            :.|..|.:.|:. ..|....:..:      |....|..|  ::.......::.|.:....|::| 
Mouse   109 AVYRVVFELIAK-EELECMSEGDVEDFPTFGDSQSDYDT--VVHPFYAHWQSFCTQKNFSWKEE- 169

  Fly   185 VDAKE--SRLEKRKHTLKLNIAPGTTAGTRFCFKEEGDRYPATIPGDIIFIAADKPHPDFERRNQ 247
            .|.::  :|.|||                  ..::|                 :|...|..|:.:
Mouse   170 YDTRQASNRWEKR------------------AMEKE-----------------NKKIRDRARKEK 199

  Fly   248 HDLVYRQSIGLCQAFTGFTFFICTLDRRQLKVVITDVVQPGYTKVVPLEGLPKCRNLDAV---TA 309
            ::|| ||.:.          ||...|:|         || .:.|:|..:...|.|..:.:   ..
Mouse   200 NELV-RQLVA----------FIRKRDKR---------VQ-AHRKLVEEQNAEKARKAEEMRRQQK 243

  Fly   310 IKEANKKVEQFGDLIIEFDYIFPKYLTPHMKHITREFFREF--RKLEIELEEEEERN 364
            :|:| |..||:.    |..::....|...::.:...:.:||  ...|.|:|::|.||
Mouse   244 LKQA-KLAEQYR----EQSWMTMANLEKELQEMEARYEKEFGDGSDENEVEDQEPRN 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 79/368 (21%)
DnaJ 7..87 CDD:278647 23/78 (29%)
DnaJ_C 156..335 CDD:199909 33/183 (18%)
Dnajc21NP_084322.2 DnaJ 3..66 CDD:278647 23/78 (29%)
DBINO <181..243 CDD:290603 20/117 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 278..309 8/18 (44%)
zf-C2H2_jaz 314..339 CDD:288983
C2H2 Zn finger 316..338 CDD:275371
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 327..480
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 507..531
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.