Sequence 1: | NP_647662.1 | Gene: | CG12020 / 38233 | FlyBaseID: | FBgn0035273 | Length: | 366 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001028327.1 | Gene: | Dnajb14 / 70604 | MGIID: | 1917854 | Length: | 379 | Species: | Mus musculus |
Alignment Length: | 281 | Identity: | 62/281 - (22%) |
---|---|---|---|
Similarity: | 95/281 - (33%) | Gaps: | 111/281 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 DYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPRQWAYVN 71
Fly 72 MAFDVLGNDLYRAIYDRFG--------------------EA--------GLFEGVMLPNG----- 103
Fly 104 ------YFPPYQY-DGDHMKVYERVFGSYSPYANVIDAI-------------SNPP-SLYATRQH 147
Fly 148 GIGVR------------SKDASTE------RIIELSLEE-----VRTGCVKLMNVW--RQEIVDA 187
Fly 188 -------KESRLEKRKHTLKL 201 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12020 | NP_647662.1 | DnaJ | 7..352 | CDD:223560 | 62/281 (22%) |
DnaJ | 7..87 | CDD:278647 | 21/79 (27%) | ||
DnaJ_C | 156..335 | CDD:199909 | 13/66 (20%) | ||
Dnajb14 | NP_001028327.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 56..90 | ||
DnaJ | 107..>214 | CDD:223560 | 29/124 (23%) | ||
DnaJ | 108..169 | CDD:278647 | 21/79 (27%) | ||
DUF1977 | 271..371 | CDD:286411 | 24/99 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |