DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and Dnajb2

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:XP_006245338.1 Gene:Dnajb2 / 689593 RGDID:1591035 Length:324 Species:Rattus norvegicus


Alignment Length:247 Identity:56/247 - (22%)
Similarity:93/247 - (37%) Gaps:68/247 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKK-DEQDFVPLAQEGRLTHLSPMGEPRQWAYVN 71
            ||.:||.||.|:.:.|..|||:.|::.  |.||. |.::|.                .:::..|.
  Rat     4 YYEILDVPRSASPDDIKKAYRKKALQW--HPDKNPDNKEFA----------------EKKFKEVA 50

  Fly    72 MAFDVLGNDLYRAIYDRFGEAGLFEGVMLPN-----GYFPPYQYD-GDHMKVYERVFGSYSPYAN 130
            .|::||.:...|.||||:|..||......|:     |..|.:.:. ....:|:...|||..|::.
  Rat    51 EAYEVLSDKHKREIYDRYGREGLTGAGSGPSRSETGGMEPGFTFTFRSPEEVFREFFGSGDPFSE 115

  Fly   131 VID-----------------------------------AISNPPSLYATRQHGIG---VRSKDAS 157
            :.|                                   :.|..|...|.|.....   |:.:..:
  Rat   116 LFDDLGAFSELQNQGSRLTGPFFTFSSSFPGNSDFSSSSFSFSPGAGAFRSVSTSTTFVQGRRIT 180

  Fly   158 TERIIELSLEEVRT---GCVKLMNVWRQEIVDAKESRLEKRKHTLKLNIAPG 206
            |.||:|...|.|..   |.:|.:::  ..:.|.....||..:...:.::.||
  Rat   181 TRRIMENGQERVEVEEDGQLKSVSI--NGVPDDLALGLELSRREQQPSVTPG 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 56/247 (23%)
DnaJ 7..87 CDD:278647 23/79 (29%)
DnaJ_C 156..335 CDD:199909 13/54 (24%)
Dnajb2XP_006245338.1 DnaJ 3..>110 CDD:223560 35/123 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.