DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and Dnajb7

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001123982.1 Gene:Dnajb7 / 685839 RGDID:1589047 Length:303 Species:Rattus norvegicus


Alignment Length:163 Identity:39/163 - (23%)
Similarity:70/163 - (42%) Gaps:50/163 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LDYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPRQWAYV 70
            :|||.||...|.|:.|.|..|||::|::..|.::.:::::                 ..|::..|
  Rat     2 VDYYEVLGVQRYASPEDIKRAYRKVALKWHPDKNPENKEE-----------------AERKFKEV 49

  Fly    71 NMAFDVLGNDLYRAIYDRFGEAGLFEGVMLPNGYFPPYQYDGDHM--------------KVYERV 121
            ..|::||.|...|.|||::|:.||..|             .|.|:              .|::.:
  Rat    50 AEAYEVLSNGEKRDIYDKYGKEGLTGG-------------GGSHLDDEREYGFTFRKADDVFKEI 101

  Fly   122 FGSYSPYA------NVIDAISNPPSLYATRQHG 148
            ||...|::      ::.|.:|:..|...:|..|
  Rat   102 FGERDPFSFHFFEDSLADLLSSSRSSSGSRSRG 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 39/162 (24%)
DnaJ 7..87 CDD:278647 22/79 (28%)
DnaJ_C 156..335 CDD:199909
Dnajb7NP_001123982.1 DnaJ 3..66 CDD:278647 22/79 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.