DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and dnajb13

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001017606.1 Gene:dnajb13 / 572669 ZFINID:ZDB-GENE-040910-4 Length:322 Species:Danio rerio


Alignment Length:345 Identity:114/345 - (33%)
Similarity:165/345 - (47%) Gaps:44/345 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDK--KDEQDFVPLAQEGRLTHLSPMGEPRQWAY 69
            ||||:|:..|.|....|..||||||::..|..:.  :..:.|..||:                  
Zfish     4 DYYAILEINRNAIDADIKKAYRRLALKHHPRSNSHARAAERFNLLAE------------------ 50

  Fly    70 VNMAFDVLGNDLYRAIYDRFGEAGLFEGV---MLPNG-YFPPYQYDGDHMKVYERVFGSYSPYAN 130
               |||||.:...:|.||:|||.||..|:   :..|| :...|.|.|:..:.:.:.||..:|:|:
Zfish    51 ---AFDVLSDPRKKATYDKFGEEGLKGGIPSELGVNGAWSSGYVYHGNADETFRQFFGGDNPFAD 112

  Fly   131 VIDAISNPPSLYATRQHGIGVRSKDASTERIIELSLEEVRTGCVKLMNVWRQEI-VDAKESRLEK 194
            ......|..:.......|...:.:|...||.:.|:||::..||.|.:.:.|:.: .|...|.:  
Zfish   113 FFTGDGNEVNAAFESLRGRKEKLQDPPIERDLHLALEDLYYGCTKKIKISRRVMNEDGHTSSI-- 175

  Fly   195 RKHTLKLNIAPGTTAGTRFCFKEEGDRYPATIPGDIIFIAADKPHPDFERRNQHDLVYRQSIGLC 259
            |...|...:..|...|||..|.:|||:.|..||.||:|:...|.||.|.|:|. ||.|.:.|.|.
Zfish   176 RDKILTFTVKAGWNEGTRITFPKEGDQGPNNIPADIVFVIRQKNHPRFVRQND-DLFYTEHISLE 239

  Fly   260 QAFTGFTFFICTLDRRQLKVVITDVVQPGYTKVVPLEGLPKCRNLDAVTAIKEANKKVEQFGDLI 324
            :|.|||:..:.|||.|.|.:.|.|:|.|.|||||..||:|             .:....:.||||
Zfish   240 KALTGFSVEVETLDGRLLNIPINDIVHPQYTKVVSGEGMP-------------LSNSPSKRGDLI 291

  Fly   325 IEFDYIFPKYLTPHMKHITR 344
            |.|...||:.|:...|.:.|
Zfish   292 IRFITHFPEKLSAEKKKLLR 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 114/345 (33%)
DnaJ 7..87 CDD:278647 24/81 (30%)
DnaJ_C 156..335 CDD:199909 67/179 (37%)
dnajb13NP_001017606.1 DnaJ 1..311 CDD:223560 113/343 (33%)
DnaJ 4..65 CDD:278647 24/81 (30%)
DnaJ_C 138..302 CDD:199909 67/179 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170584021
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 1 1.010 - - D1393097at2759
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24078
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.