DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and dnajb5

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001093510.1 Gene:dnajb5 / 569466 ZFINID:ZDB-GENE-070705-308 Length:360 Species:Danio rerio


Alignment Length:389 Identity:111/389 - (28%)
Similarity:169/389 - (43%) Gaps:87/389 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DYYAVLDQPRGATKEQITLAYRRLAIRLCP--HRDKKDEQDFVPLAQEGRLTHLSPMGEPRQWAY 69
            |||.:|..|.|:.:::|..|||::|::..|  ::|...|:.|..:|:                  
Zfish     4 DYYKILGIPSGSNEDEIKKAYRKMALKFHPDKNKDPNAEEKFKEIAE------------------ 50

  Fly    70 VNMAFDVLGNDLYRAIYDRFGEAGL-FEGVMLPNGYFPPYQY--DGDHMKVYERVFGSYSPY--- 128
               |::||.:...|.|||::||.|| ..|....:|....|.|  .||....:...||..:|:   
Zfish    51 ---AYEVLSDPKKRVIYDQYGEDGLKTGGTGSSSGQGTTYHYTFHGDPHATFASFFGGSNPFDIF 112

  Fly   129 -------ANV--------------IDAISNPPSLYA--------TRQHGIGVRSK---------- 154
                   .|.              :|...:|.|.::        ...||.|.|.:          
Zfish   113 FGSSRQRGNTNGFPDHGDHDMDIDMDGEDDPFSSFSHFGFNGVNGFHHGGGRRHRNEPLHGGRKK 177

  Fly   155 --DASTERIIELSLEEVRTGCVKLMNVWRQEI-VDAKESRLEKRKHTLKLNIAPGTTAGTRFCFK 216
              |......:::||||:..||.|.|.:.|:.: .|.|..|.|.:  .|.:.|..|...||:..|.
Zfish   178 LQDPPVVHELKVSLEEIFHGCTKRMRITRRRLNPDRKTMRTEDK--ILNIVIKRGWKEGTKITFP 240

  Fly   217 EEGDRYPATIPGDIIFIAADKPHPDFERRNQHDLVYRQSIGLCQAFTGFTFFICTLDRRQLKVVI 281
            :|||..|..||.||.|:..||.||.| ||:..:::|...|||.:|..|.|..|.|:|.|.:.:..
Zfish   241 KEGDETPENIPADIAFVLKDKGHPLF-RRDGSNIIYTTKIGLKEALCGCTVNIPTIDNRAITLPC 304

  Fly   282 TDVVQPGYTKVVPLEGLPKCRNLDAVTAIKEANKKVEQFGDLIIEFDYIFPKYLTPHMKHITRE 345
            .|:::||..|.:..||||..:|             ..|.||||:||...||..:.|..:.|.::
Zfish   305 NDIIKPGTIKRLRGEGLPFPKN-------------PSQRGDLIVEFQVRFPDRIPPQSREIIKQ 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 111/389 (29%)
DnaJ 7..87 CDD:278647 21/81 (26%)
DnaJ_C 156..335 CDD:199909 64/179 (36%)
dnajb5NP_001093510.1 DnaJ 1..355 CDD:223560 111/387 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 1 1.010 - - D1393097at2759
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.