DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and Dnajb2

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:XP_036008391.1 Gene:Dnajb2 / 56812 MGIID:1928739 Length:365 Species:Mus musculus


Alignment Length:226 Identity:45/226 - (19%)
Similarity:76/226 - (33%) Gaps:70/226 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 RAIYDRFGEAGLFEGVMLPN-----GYFPPYQYD-GDHMKVYERVFGSYSPYANVID-------- 133
            |.||||:|..||......|:     |..|.:.:. ....:|:...|||..|::.:.|        
Mouse   103 REIYDRYGREGLTGAGSGPSRSETGGAGPGFTFTFRSPEEVFREFFGSGDPFSELFDDLGVFSEL 167

  Fly   134 ---------------------------AISNPPSLYATRQHGIG---VRSKDASTERIIELSLEE 168
                                       :.|..|...|.|.....   |:.:..:|.||:|..   
Mouse   168 QNQGPRLTGPFFTFSSSFPANSDFSSSSFSFSPGAGAFRSVSTSTTFVQGRRITTRRIMENG--- 229

  Fly   169 VRTGCVKLMNVWRQEIVDAKESRLEKRKHTLKLNIAPGTTA-GTRFCFKEEGDRYPATIPGDIIF 232
                         ||.|:.:|   :.:..::.:|..|...| |.....:|:   .|:..||  :.
Mouse   230 -------------QERVEVEE---DGQLKSVSINGVPDDLALGLELSRREQ---QPSVAPG--LG 273

  Fly   233 IAADKPHPDFERRNQHDLVYRQSIGLCQAFT 263
            :...:| ....|...|||...:.:.|..|::
Mouse   274 VMQVRP-TSLSRPPDHDLSEDEDLQLAMAYS 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 45/226 (20%)
DnaJ 7..87 CDD:278647 2/3 (67%)
DnaJ_C 156..335 CDD:199909 23/109 (21%)
Dnajb2XP_036008391.1 PRK14294 102..>151 CDD:237664 14/47 (30%)
UIM 291..310 CDD:197845 2/13 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.