Sequence 1: | NP_647662.1 | Gene: | CG12020 / 38233 | FlyBaseID: | FBgn0035273 | Length: | 366 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_036008391.1 | Gene: | Dnajb2 / 56812 | MGIID: | 1928739 | Length: | 365 | Species: | Mus musculus |
Alignment Length: | 226 | Identity: | 45/226 - (19%) |
---|---|---|---|
Similarity: | 76/226 - (33%) | Gaps: | 70/226 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 83 RAIYDRFGEAGLFEGVMLPN-----GYFPPYQYD-GDHMKVYERVFGSYSPYANVID-------- 133
Fly 134 ---------------------------AISNPPSLYATRQHGIG---VRSKDASTERIIELSLEE 168
Fly 169 VRTGCVKLMNVWRQEIVDAKESRLEKRKHTLKLNIAPGTTA-GTRFCFKEEGDRYPATIPGDIIF 232
Fly 233 IAADKPHPDFERRNQHDLVYRQSIGLCQAFT 263 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12020 | NP_647662.1 | DnaJ | 7..352 | CDD:223560 | 45/226 (20%) |
DnaJ | 7..87 | CDD:278647 | 2/3 (67%) | ||
DnaJ_C | 156..335 | CDD:199909 | 23/109 (21%) | ||
Dnajb2 | XP_036008391.1 | PRK14294 | 102..>151 | CDD:237664 | 14/47 (30%) |
UIM | 291..310 | CDD:197845 | 2/13 (15%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |