DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and Dnajb8

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_064348.1 Gene:Dnajb8 / 56691 MGIID:1922801 Length:227 Species:Mus musculus


Alignment Length:249 Identity:57/249 - (22%)
Similarity:85/249 - (34%) Gaps:102/249 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DYYAVLDQPRGATKEQITLAYRRLAIRLCPHR--DKKDEQDFVPLAQEGRLTHLSPMGEPRQWAY 69
            :||.||.....|:.|.|..|||:||:|..|.:  |.|:|.:                   :::..
Mouse     3 NYYEVLGVQSSASPEDIKKAYRKLALRWHPDKNPDNKEEAE-------------------KKFKQ 48

  Fly    70 VNMAFDVLGNDLYRAIYDRFG----EAGLFEGVMLPN------GYFPPYQYDGDHMKVYERVFGS 124
            |:.|::||.:...|::|||.|    .||  .|..:|:      ||  |::...|   ::...||.
Mouse    49 VSEAYEVLSDSKKRSVYDRAGCDRWRAG--GGANVPHSSPFGAGY--PFRNPED---IFREFFGG 106

  Fly   125 YSPYA-------------------------NVIDAISNPPSLYATRQHGIGVRS----------- 153
            ..|::                         ....|.....|.:.|..||.|.||           
Mouse   107 LDPFSFEFWDTPFSGRGRPHGLHRVFPSGFGEFPAFMEALSSFNTLGHGGGSRSTFSSASFGGSG 171

  Fly   154 ----------------KDASTERIIELSLEEVR------------TGCVKLMNV 179
                            :..:|:||||...|.|.            .|..|||.|
Mouse   172 SSGFKSVMSSTEMVNGRKVTTKRIIENGQERVEVEEDGQLRSVTVNGKEKLMRV 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 57/249 (23%)
DnaJ 7..87 CDD:278647 22/81 (27%)
DnaJ_C 156..335 CDD:199909 12/36 (33%)
Dnajb8NP_064348.1 DnaJ 3..66 CDD:278647 22/81 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.