DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and Dnajb5

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001342367.1 Gene:Dnajb5 / 56323 MGIID:1930018 Length:420 Species:Mus musculus


Alignment Length:384 Identity:109/384 - (28%)
Similarity:165/384 - (42%) Gaps:89/384 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKD--EQDFVPLAQEGRLTHLSPMGEPRQWAY 69
            |||.:|..|.||.:::|..|||::|::..|.::|:.  |:.|..:|:                  
Mouse    76 DYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAE------------------ 122

  Fly    70 VNMAFDVLGNDLYRAIYDRFGEAGLFEGVMLPNGYFPPYQY--DGDHMKVYERVFGSYSPYANVI 132
               |:|||.:...|::||::||.||..|.....|....:.|  .||....:...||..:|: ::.
Mouse   123 ---AYDVLSDPKKRSLYDQYGEEGLKTGGGSSGGSGGSFHYTFHGDPHATFASFFGGSNPF-DIF 183

  Fly   133 DAISN----------------------------------------PPSLYATRQHGIGVRSKDAS 157
            .|.|.                                        |..||..|      :.:|..
Mouse   184 FASSRSTRPFSGFDPDDMDVDEDEDPFGAFGRFGFNGLSRGPRRAPEPLYPRR------KVQDPP 242

  Fly   158 TERIIELSLEEVRTGCVKLMNVWRQEI-VDAKESRLEKRKHTLKLNIAPGTTAGTRFCFKEEGDR 221
            ....:.:||||:..|..|.|.:.|:.: .|.:..|.|.:  .|.:.|..|...||:..|.:|||.
Mouse   243 VVHELRVSLEEIYHGSTKRMKITRRRLNPDGRTVRTEDK--ILHIVIKRGWKEGTKITFPKEGDA 305

  Fly   222 YPATIPGDIIFIAADKPHPDFERRNQHDLVYRQSIGLCQAFTGFTFFICTLDRRQLKVVITDVVQ 286
            .|..||.||:|:..||||..| ||:..:::|...|.|.:|..|.|..|.|:|.|.:.:...||::
Mouse   306 TPDNIPADIVFVLKDKPHAHF-RRDGTNVLYSALISLKEALCGCTVNIPTIDGRVIPLPCNDVIK 369

  Fly   287 PGYTKVVPLEGLPKCRNLDAVTAIKEANKKVEQFGDLIIEFDYIFPKYLTPHMKHITRE 345
            ||..|.:..||||             ..|...|.||||:||...||..|||..:.|.::
Mouse   370 PGTVKRLRGEGLP-------------FPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQ 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 109/384 (28%)
DnaJ 7..87 CDD:278647 22/81 (27%)
DnaJ_C 156..335 CDD:199909 62/179 (35%)
Dnajb5NP_001342367.1 DnaJ 72..415 CDD:223560 109/382 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 1 1.010 - - D1393097at2759
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.