DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and dnajc18

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001107060.1 Gene:dnajc18 / 559928 ZFINID:ZDB-GENE-030131-8019 Length:407 Species:Danio rerio


Alignment Length:315 Identity:59/315 - (18%)
Similarity:105/315 - (33%) Gaps:129/315 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPRQWAYVN 71
            |:|.:|..|:||:.|.:..|||:||:|.  |.||                :.:| |....:..:.
Zfish   121 DFYEILGVPKGASDEDLKKAYRKLALRF--HPDK----------------NCAP-GATDAFKAIG 166

  Fly    72 MAFDVLGNDLYRAIYDRFGEAG-------------------------------------LFEGVM 99
            .|:.||.|...|..||.:|:.|                                     :|.|..
Zfish   167 NAYAVLSNPEKRQQYDEYGDQGPAETSSQPSAQPRQAYARHRSFTRDFEPDISPEELFNIFFGGR 231

  Fly   100 LPNGYFPPY---------QYDGDHMKVYER---------VFGSYSPYANVIDAI----------- 135
            .|.|....|         .|.....:.:||         ...:::|...::..:           
Zfish   232 FPTGNIHVYTNGGASYAHYYQPRRRRPFERREEEVEESHSTNNFTPLLQLLPVLVLIVISVFTQL 296

  Fly   136 --SNPP-SLYATRQHGIGVRSK----------DAS------------TERIIELS-LEEVRTGCV 174
              :||| ||:.....|:.|..:          |.|            .|:.||.. ::.:::.| 
Zfish   297 MATNPPYSLFYKPSMGLVVSRETQHMGVPYYVDKSFEKEYRGAALDELEKTIETDYIDHLQSSC- 360

  Fly   175 KLMNVWRQEIVDA---------KESRLEKRKHTLKLNIAPGTTAGTRFCFKEEGD 220
                 |:::...:         ::.||:::..|:||:.....   .||..::.||
Zfish   361 -----WKEKQQKSDLANLGQLYRDERLKQKAETMKLDHCDKL---HRFIGRQRGD 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 59/315 (19%)
DnaJ 7..87 CDD:278647 23/79 (29%)
DnaJ_C 156..335 CDD:199909 15/87 (17%)
dnajc18NP_001107060.1 DnaJ 121..182 CDD:278647 23/79 (29%)
DUF1977 299..399 CDD:286411 19/108 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.