Sequence 1: | NP_647662.1 | Gene: | CG12020 / 38233 | FlyBaseID: | FBgn0035273 | Length: | 366 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001107060.1 | Gene: | dnajc18 / 559928 | ZFINID: | ZDB-GENE-030131-8019 | Length: | 407 | Species: | Danio rerio |
Alignment Length: | 315 | Identity: | 59/315 - (18%) |
---|---|---|---|
Similarity: | 105/315 - (33%) | Gaps: | 129/315 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 DYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPRQWAYVN 71
Fly 72 MAFDVLGNDLYRAIYDRFGEAG-------------------------------------LFEGVM 99
Fly 100 LPNGYFPPY---------QYDGDHMKVYER---------VFGSYSPYANVIDAI----------- 135
Fly 136 --SNPP-SLYATRQHGIGVRSK----------DAS------------TERIIELS-LEEVRTGCV 174
Fly 175 KLMNVWRQEIVDA---------KESRLEKRKHTLKLNIAPGTTAGTRFCFKEEGD 220 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12020 | NP_647662.1 | DnaJ | 7..352 | CDD:223560 | 59/315 (19%) |
DnaJ | 7..87 | CDD:278647 | 23/79 (29%) | ||
DnaJ_C | 156..335 | CDD:199909 | 15/87 (17%) | ||
dnajc18 | NP_001107060.1 | DnaJ | 121..182 | CDD:278647 | 23/79 (29%) |
DUF1977 | 299..399 | CDD:286411 | 19/108 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |