DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and dnajc16

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:XP_005166271.1 Gene:dnajc16 / 559762 ZFINID:ZDB-GENE-130530-683 Length:777 Species:Danio rerio


Alignment Length:384 Identity:79/384 - (20%)
Similarity:126/384 - (32%) Gaps:137/384 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ELDYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQD--FVPLAQEGRLTHLSPMGEPRQW 67
            |.|.|.||...|.|::.:|...|:|||....|.::|..|.:  |:.:.:                
Zfish    27 EFDPYKVLGVTRSASQAEIKKVYKRLAKEWHPDKNKNPEAEDMFIKITK---------------- 75

  Fly    68 AYVNMAFDVLGNDLYRAIYDRFGEAGLFEGVMLPNG-------------YFP------PYQYDGD 113
                 ::::|.|:..||.|||:|:....:    |.|             ||.      |:...|.
Zfish    76 -----SYEILTNEEKRASYDRYGQTDDTQ----PYGHRHHGFRHFHDNFYFDESFFHFPFNNKGG 131

  Fly   114 HMKVYERVFGSYSPYAN--VIDAISNP-----------------PSLYATRQH----GIGVRSKD 155
            ......:....::.|.|  |.|:...|                 |....|.|.    |||:...|
Zfish   132 RDFADSKYTLHFNQYVNEVVPDSFKRPYLIKITSDWCFSCIHIEPVWKETVQELETLGIGIGVVD 196

  Fly   156 ASTERIIELSLEEVRTGCVKLMNVWRQEIVDAKESRLE---KRKHTLKLNIAPGTTAGTRFCFKE 217
            ...||.:...|...:|..:       ..:|:.|.|...   .::|.::              |.:
Zfish   197 VGYERRLANHLGAHQTPSI-------LGVVNGKVSFFHYAVVKEHLIQ--------------FVD 240

  Fly   218 EGDRYPATIPGDIIFIAADKPHPDF-----ERRNQHDLVYRQ--SIGLCQAFTGFTFFICTLDRR 275
            :      .:|..:|....||.:.:|     |....|.|::.|  |:.|....|.|.|        
Zfish   241 D------LLPQRLIEKVTDKNNHEFLKSWHELNKPHVLLFDQVPSVPLLYKLTAFAF-------- 291

  Fly   276 QLKVVITDVVQPGYTKVVPLEGLPKCRNL----------DAVTAIKEANKKVEQFGDLI 324
                  .|.||.||..    :||.:...|          ..:...||   .||:..|:|
Zfish   292 ------KDYVQFGYVD----QGLSETAELLRKFNINTYAPTMLVFKE---DVEKPADII 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 78/382 (20%)
DnaJ 7..87 CDD:278647 19/81 (23%)
DnaJ_C 156..335 CDD:199909 37/189 (20%)
dnajc16XP_005166271.1 DnaJ 29..90 CDD:278647 19/81 (23%)
TRX_DnaJ 133..242 CDD:239261 21/135 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.