DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and dnajb2

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:XP_012825839.2 Gene:dnajb2 / 548454 XenbaseID:XB-GENE-951530 Length:361 Species:Xenopus tropicalis


Alignment Length:307 Identity:68/307 - (22%)
Similarity:111/307 - (36%) Gaps:97/307 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LDYYAVLDQPRGATKEQITLAYRRLAIRLCPHR--DKKD--EQDFVPLAQEGRLTHLSPMGEPRQ 66
            :|||.:|..||.|:::.|..|||:||:|..|.:  |.|:  |:.|..:|:               
 Frog     2 VDYYDILGVPRNASQDDIKRAYRKLALRWHPDKNPDNKEHAERKFKDIAE--------------- 51

  Fly    67 WAYVNMAFDVLGNDLYRAIYDR----FGEAGLFEGVMLPNGYFPPYQYDGDHMKVYERVFGSYSP 127
                  |::||.:...|..||.    |.:.|.|....:...:...:|:.... .|:...||...|
 Frog    52 ------AYEVLSDGEKREAYDNMTSGFSDPGAFRATRVQRPFDFGFQFRSPE-DVFRDFFGGKDP 109

  Fly   128 YANVI--DAISNPPSLYATRQH----------------------GIG--------------VRSK 154
            :.::|  |....|...:....|                      |:|              |..|
 Frog   110 FPHMIGDDVFMFPNHPHGVTHHANSVPMFPSSFHFGNEFSFHSGGLGGSRNFCSVSTSTKFVNGK 174

  Fly   155 DASTERIIELSLEEVRT---GCVK--LMNVWRQEIVDAKESRLEKRKHTLKLNIAPGTTAGTRFC 214
            ..:|:||:|..:|.:..   |.:|  |:|....::..|.|  |.||:.. .:..|...|.|..:.
 Frog   175 RITTKRIMENDVERIEVEEDGELKSILVNGVEDDLALAVE--LSKREQA-SVPRASARTDGPSYN 236

  Fly   215 FKEEGDRYPATIPGDIIFIAADKPHPD-------------FERRNQH 248
            .::   |.|...|     :..|:...|             ||:..||
 Frog   237 IQQ---RSPPGTP-----VVQDRDDEDEELQLAMACSLSEFEQSRQH 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 68/306 (22%)
DnaJ 7..87 CDD:278647 24/83 (29%)
DnaJ_C 156..335 CDD:199909 26/111 (23%)
dnajb2XP_012825839.2 PRK10767 3..>106 CDD:236757 32/124 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.