DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and AT3G06778

DIOPT Version :10

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001078117.1 Gene:AT3G06778 / 5007987 AraportID:AT3G06778 Length:229 Species:Arabidopsis thaliana


Alignment Length:164 Identity:34/164 - (20%)
Similarity:60/164 - (36%) Gaps:44/164 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LDYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQD---------FVPLAQE--------- 52
            :|:|.:|.....|..:.|...|.:||:::.|.::...:.|         ::.|:.|         
plant    41 IDWYLILGIQEDAEVKVIRKRYHKLALKVHPDKNNHPKADIAFKLIHEAYLCLSDETKRRSFNID 105

  Fly    53 ---------GRLTHLSPMGEPRQWAYVNMAFDVLGNDLYRAIYDRFGEAGL-FEGVMLPNGYFPP 107
                     .|::|.|.  |.|..:..|.....|     :.|.|:|.|..: .|..:..|..|  
plant   106 RRNNICLKCSRVSHKSK--ENRNDSKPNRFCQTL-----KDIRDKFREENMVIERCLKTNSAF-- 161

  Fly   108 YQYDGDHMKVYERVFGSYSPYANVID---AISNP 138
              :.|:.......|:|  .|..|.|:   .:.||
plant   162 --FMGNRTNETPPVYG--IPKQNRINKESPVFNP 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 PRK14289 7..299 CDD:237660 34/163 (21%)
DnaJ_C 156..335 CDD:199909
AT3G06778NP_001078117.1 DnaJ 42..103 CDD:395170 12/60 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.