DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and DNAJB9

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_036460.1 Gene:DNAJB9 / 4189 HGNCID:6968 Length:223 Species:Homo sapiens


Alignment Length:149 Identity:32/149 - (21%)
Similarity:57/149 - (38%) Gaps:24/149 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPRQWAYVNM 72
            ||.:|..|:.|::.||..|:.:||::..|.::|..:       .|.:...::...|....|....
Human    27 YYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPD-------AEAKFREIAEAYETLSDANRRK 84

  Fly    73 AFDVLGNDLYRAIYDRFGEAGLFEGVMLPN--GYFPPYQYDGDHMKVYERVFGSYSPYANVIDAI 135
            .:|.||:..:.:...:.|....||.....|  ..|..:.:.|.:...     ||...:.|     
Human    85 EYDTLGHSAFTSGKGQRGSGSSFEQSFNFNFDDLFKDFGFFGQNQNT-----GSKKRFEN----- 139

  Fly   136 SNPPSLYATRQHGIGVRSK 154
                 .:.|||.|...|.:
Human   140 -----HFQTRQDGGSSRQR 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 32/149 (21%)
DnaJ 7..87 CDD:278647 18/78 (23%)
DnaJ_C 156..335 CDD:199909
DNAJB9NP_036460.1 type 2 signal-anchor for ER localization 7..23
DnaJ 26..>136 CDD:333066 26/120 (22%)
Divergent targeting domain. /evidence=ECO:0000250|UniProtKB:Q9QYI6 91..223 14/78 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.