DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and CG3061

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster


Alignment Length:146 Identity:38/146 - (26%)
Similarity:52/146 - (35%) Gaps:47/146 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPRQWAYVN 71
            |||.||...:.||..:|..||::||::|.|.::|      .|.|.|                   
  Fly   106 DYYEVLGVSKTATDSEIKKAYKKLALQLHPDKNK------APGAVE------------------- 145

  Fly    72 MAFDVLGN--------------DLY--RAIYDRFGEAG---LFEGVMLPN--GYFPPYQYDGDHM 115
             ||..|||              |||  ...::..|..|   ...|....|  ||...:|.|....
  Fly   146 -AFKALGNAAGVLTDAEKRKNYDLYGINESHNGHGNNGGGHHGHGQYYNNEYGYSRGFQADISAE 209

  Fly   116 KVYERVFGSYSPYANV 131
            :::...|....|..||
  Fly   210 ELFNMFFNGGFPQQNV 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 38/146 (26%)
DnaJ 7..87 CDD:278647 26/95 (27%)
DnaJ_C 156..335 CDD:199909
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 36/143 (25%)
DnaJ 106..167 CDD:278647 23/86 (27%)
DUF1977 269..366 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458985
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.