DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and CG11035

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster


Alignment Length:276 Identity:57/276 - (20%)
Similarity:100/276 - (36%) Gaps:90/276 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RPELDYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPRQW 67
            |.::.:|..|...|..|:.:|..||.:|::...|.|::..|                  ...:::
  Fly    23 RHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSE------------------NAAKKF 69

  Fly    68 AYVNMAFDVLGNDLYRAIYDRFGEAGLFEGVMLPNGYFPPYQYDGDHMKVYERV---------FG 123
            ..:|.|:::|||...|.:||:        |::...|    .||..|...|.|.|         :.
  Fly    70 REINQAYEILGNYRLRRLYDK--------GIVHTAG----AQYAQDVHDVAEPVVEDDAETKFYK 122

  Fly   124 SYSPYANVIDAISNPPSLYA----TRQHGIGVRSKDASTERIIELSLEEVRTGCVKLMNVWRQEI 184
            |....:.|.|:....| :|.    :|.| .| :|.|                         |::.
  Fly   123 SRFQKSRVSDSAGRTP-IYDFDEWSRNH-YG-KSFD-------------------------RRQA 159

  Fly   185 VDAKESRLEKRKHTLKLNIAPGTTAGTRFCFKEEGDRYPATIPGDIIFIAA---DKPHPDFERRN 246
            ..||..|::.::.|.:::   |.|......|...|      :...::|:|.   |.|....:.|.
  Fly   160 AQAKYDRIKVQRETNRIS---GQTDMVLLAFIFAG------VAVYLMFLAESSYDTPKQKAKERY 215

  Fly   247 QHD-------LVYRQS 255
            :.|       ||.:||
  Fly   216 RRDQEEREQKLVGKQS 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 56/272 (21%)
DnaJ 7..87 CDD:278647 17/79 (22%)
DnaJ_C 156..335 CDD:199909 19/110 (17%)
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 17/80 (21%)
DnaJ 27..89 CDD:278647 17/79 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.