DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and CG7130

DIOPT Version :10

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_649380.1 Gene:CG7130 / 40450 FlyBaseID:FBgn0037151 Length:128 Species:Drosophila melanogaster


Alignment Length:88 Identity:33/88 - (37%)
Similarity:43/88 - (48%) Gaps:19/88 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPRQWAYVN 71
            |||.:|...|.|:.|.:...|||:|:|.  |.||.|.    |.|:|             |:..|.
  Fly     4 DYYKILGIERNASSEDVKKGYRRMALRY--HPDKNDH----PQAEE-------------QFREVV 49

  Fly    72 MAFDVLGNDLYRAIYDRFGEAGL 94
            .||:||.:...|.|||:.||.||
  Fly    50 AAFEVLFDKEKREIYDQHGEEGL 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 PRK14289 7..299 CDD:237660 33/88 (38%)
DnaJ_C 156..335 CDD:199909
CG7130NP_649380.1 DnaJ_bact 4..>73 CDD:274090 33/88 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.