DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and DnaJ-1

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster


Alignment Length:362 Identity:109/362 - (30%)
Similarity:164/362 - (45%) Gaps:66/362 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPRQWAYVN 71
            |:|.:|...|.|:.::|..|||:||::..|.::|                  ||..|.| :..:.
  Fly     4 DFYKILGLERKASDDEIKKAYRKLALKYHPDKNK------------------SPQAEER-FKEIA 49

  Fly    72 MAFDVLGNDLYRAIYDRFGEAGLFEGVMLPNGYFPP----YQYDGDHMKVYERVFGSYSPYANVI 132
            .|::||.:...|.|:|.:||.||..|...|:|...|    ||:.||....:.:.|||..|:....
  Fly    50 EAYEVLSDKKKRDIFDNYGEDGLKGGQPGPDGGGQPGAYTYQFHGDPRATFAQFFGSSDPFGAFF 114

  Fly   133 DAISNPPSLYATRQHG--------IG--------------VRSKDASTERIIELSLEEVRTGCVK 175
            ....|   :::..|.|        ||              .|.:|...|..:.:|||||..||:|
  Fly   115 TGGDN---MFSGGQGGNTNEIFWNIGGDDMFAFNAQAPSRKRQQDPPIEHDLFVSLEEVDKGCIK 176

  Fly   176 LMNVWRQEIVDAKESRLEKRKHTLKLNIAPGTTAGTRFCFKEEGDRYPATIPGDIIFIAADKPHP 240
            .|.:.|.........:.||   .|::.:.||..|||:..|.:|||..|...|.||:||..||||.
  Fly   177 KMKISRMATGSNGPYKEEK---VLRITVKPGWKAGTKITFPQEGDSAPNKTPADIVFIIRDKPHS 238

  Fly   241 DFERRNQHDLVYRQSIGLCQAFTGFTFFICTLDRRQLKVVIT-DVVQPGYTKVVPLEGLPKCRNL 304
            .|:|.. .||.|...|.|.||..|....:.||...:::|... ::::|..|:.:...|||     
  Fly   239 LFKREG-IDLKYTAQISLKQALCGALVSVPTLQGSRIQVNPNHEIIKPTTTRRINGLGLP----- 297

  Fly   305 DAVTAIKEANKKVEQFGDLIIEFDYIFPKYLTPHMKH 341
                ..||.:::    ||||:.||..||..|.|.:::
  Fly   298 ----VPKEPSRR----GDLIVSFDIKFPDTLAPSLQN 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 109/362 (30%)
DnaJ 7..87 CDD:278647 22/79 (28%)
DnaJ_C 156..335 CDD:199909 61/179 (34%)
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 109/362 (30%)
DnaJ 4..65 CDD:278647 22/79 (28%)
DnaJ_C 157..320 CDD:199909 61/179 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458994
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1393097at2759
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24078
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.