DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and DNAJB13

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:XP_011543306.1 Gene:DNAJB13 / 374407 HGNCID:30718 Length:350 Species:Homo sapiens


Alignment Length:332 Identity:114/332 - (34%)
Similarity:162/332 - (48%) Gaps:38/332 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPRQWAYVNMAFDVLGNDLY 82
            :|.|.....|||||::  .|..|.:|.....:.::                 :..|:|||.:.:.
Human    49 STAEDKDQRYRRLALK--HHPLKSNEPSSAEIFRQ-----------------IAEAYDVLSDPMK 94

  Fly    83 RAIYDRFGEAGLFEGVMLPNGYFPP----YQYDGDHMKVYERVFGSYSPYANVIDAISNPPSLYA 143
            |.|||:|||.||..|:.|..|...|    |.:.|...||:...||..:|::...||..:...|..
Human    95 RGIYDKFGEEGLKGGIPLEFGSQTPWTTGYVFHGKPEKVFHEFFGGNNPFSEFFDAEGSEVDLNF 159

  Fly   144 TRQHGIGVRSKDASTERIIELSLEEVRTGCVKLMNVWRQEIVDAKESRLEKRKHTLKLNIAPGTT 208
            ....|.||:.:|...||.:.||||::..||.|.:.:.|:.:.:...|...|.| .|.:::.||..
Human   160 GGLQGRGVKKQDPQVERDLYLSLEDLFFGCTKKIKISRRVLNEDGYSSTIKDK-ILTIDVKPGWR 223

  Fly   209 AGTRFCFKEEGDRYPATIPGDIIFIAADKPHPDFERRNQHDLVYRQSIGLCQAFTGFTFFICTLD 273
            .|||..|::|||:.|..||.|||||..:|.||.|.|.|. :|.:...|.|.:|.|..|..:.|||
Human   224 QGTRITFEKEGDQGPNIIPADIIFIVKEKLHPRFRREND-NLFFVNPIPLGKALTCCTVEVRTLD 287

  Fly   274 RRQLKVVITDVVQPGYTKVVPLEGLPKCRNLDAVTAIKEANKKVEQFGDLIIEFDYIFPKYLTPH 338
            .|.|.:.|.|::.|.|.|.||.||:|         ..::..||    |||.|.||..||..|||.
Human   288 DRLLNIPINDIIHPKYFKKVPGEGMP---------LPEDPTKK----GDLFIFFDIQFPTRLTPQ 339

  Fly   339 MKHITRE 345
            .|.:.|:
Human   340 KKQMLRQ 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 114/332 (34%)
DnaJ 7..87 CDD:278647 16/68 (24%)
DnaJ_C 156..335 CDD:199909 68/178 (38%)
DNAJB13XP_011543306.1 DnaJ_bact 48..346 CDD:274090 113/330 (34%)
DnaJ 48..99 CDD:278647 16/68 (24%)
DnaJ_C 174..336 CDD:199909 68/176 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149878
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 1 1.010 - - D1393097at2759
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24078
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.