DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and mrj

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster


Alignment Length:84 Identity:24/84 - (28%)
Similarity:41/84 - (48%) Gaps:21/84 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LDYYAVLDQPRGATKEQITLAYRRLAIRLCPHR--DKKDEQDFVPLAQEGRLTHLSPMGEPRQWA 68
            :|||.:||..|.||..::..|||:||::..|.:  |..||.:                   :::.
  Fly     2 VDYYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEAN-------------------KRFR 47

  Fly    69 YVNMAFDVLGNDLYRAIYD 87
            .::.|::||.:...|.|||
  Fly    48 ELSEAYEVLSDARKRRIYD 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 24/83 (29%)
DnaJ 7..87 CDD:278647 22/81 (27%)
DnaJ_C 156..335 CDD:199909
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 22/82 (27%)
DnaJ 3..66 CDD:278647 22/81 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458991
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.