DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and Dnajb1

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001382078.1 Gene:Dnajb1 / 361384 RGDID:1304725 Length:340 Species:Rattus norvegicus


Alignment Length:366 Identity:114/366 - (31%)
Similarity:165/366 - (45%) Gaps:86/366 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKD--EQDFVPLAQEGRLTHLSPMGEPRQWAY 69
            |||..|...|||:.::|..||||.|:|..|.::|:.  |:.|..:|:                  
  Rat     4 DYYQTLGLARGASDDEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAE------------------ 50

  Fly    70 VNMAFDVLGNDLYRAIYDRFGEAGLFEGVMLP--------NGYFPPYQYDGDHMKVYERVFGSYS 126
               |:|||.:...|.|:||:||.||..|.  |        ||....|.:.||...::...||..:
  Rat    51 ---AYDVLSDPRKREIFDRYGEEGLKGGG--PSGGSSGGANGTSFSYTFHGDPHAMFAEFFGGRN 110

  Fly   127 PY------------ANVIDAISNPPSLYATRQHGIG----------------VRSK-DASTERII 162
            |:            .::.|..|:.|.       |:|                .|.| |......:
  Rat   111 PFDTFFGQRNGEEGMDIDDPFSSFPM-------GMGGFTNMNFGRSRPTQEPTRKKQDPPVTHDL 168

  Fly   163 ELSLEEVRTGCVKLMNVWRQEI-VDAKESRLEKRKHTLKLNIAPGTTAGTRFCFKEEGDRYPATI 226
            .:||||:.:||.|.|.:..:.: .|.|..|.|.:  .|.:.:..|...||:..|.:|||:....|
  Rat   169 RVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDK--ILTIEVKRGWKEGTKITFPKEGDQTSNNI 231

  Fly   227 PGDIIFIAADKPHPDFERRNQHDLVYRQSIGLCQAFTGFTFFICTLDRRQLKVVITDVVQPGYTK 291
            |.||:|:..||||..| :|:..|::|...|.|.:|..|.|..:.|||.|.:.||..||::||..:
  Rat   232 PADIVFVLKDKPHNIF-KRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRR 295

  Fly   292 VVPLEGLPKCRNLDAVTAIKEANKKVEQFGDLIIEFDYIFP 332
            .||.||||             ..|..|:.|||:|||:.|||
  Rat   296 KVPGEGLP-------------LPKTPEKRGDLVIEFEVIFP 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 114/366 (31%)
DnaJ 7..87 CDD:278647 25/81 (31%)
DnaJ_C 156..335 CDD:199909 65/178 (37%)
Dnajb1NP_001382078.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 1 1.010 - - D1393097at2759
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.