DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and Dnajb11

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001015021.1 Gene:Dnajb11 / 360734 RGDID:1307373 Length:358 Species:Rattus norvegicus


Alignment Length:380 Identity:99/380 - (26%)
Similarity:152/380 - (40%) Gaps:96/380 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPRQWAYVN 71
            |:|.:|..||.|:.:.|..|||:||::|.|.|:..|     |.|||             ::..:.
  Rat    25 DFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDD-----PQAQE-------------KFQDLG 71

  Fly    72 MAFDVLGNDLYRAIYDRFGEAGLFEGVMLPNGYFPPYQYDGDHMKVYERVFGSYSPYANVIDAIS 136
            .|::||.:...|..||.:||.||.:|            :...|..::...||.:.          
  Rat    72 AAYEVLSDSEKRKQYDTYGEEGLKDG------------HQSSHGDIFSHFFGDFG---------- 114

  Fly   137 NPPSLY--ATRQHGIGV-RSKDASTERIIELSLEEVRTG----------------------CVKL 176
               .::  |.||....: |..|...:  :|::||||..|                      |.:.
  Rat   115 ---FMFGGAPRQQDRNIPRGSDIIVD--LEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQE 174

  Fly   177 MNVWR---------QEIV--DAKESRLEKRKHTLKLNIAPGTTAGTRFCFKEEGDRYPATIPGDI 230
            |...:         ||:|  :....:|...:.||::.|.||...|..:.|..||:.:....|||:
  Rat   175 MRTTQLGPGRFQMTQEVVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDL 239

  Fly   231 IFIAADKPHPDFERRNQHDLVYRQSIGLCQAFTGFTFFICTLDRRQLKVVITDVVQPGYTKVVPL 295
            .|......|..||||.. ||....::.|.:|..||...|..||..::.:....:.:||.......
  Rat   240 RFRIKVVKHRIFERRGD-DLYTNVTVSLVEALVGFEMDITHLDGHKVHISRDKITRPGAKLWKKG 303

  Fly   296 EGLPKCRNLDAVTAIKEANKKVEQFGDLIIEFDYIFPK-YLTPHMKHITREFFRE 349
            ||||   |.|        |..::  |.|||.||..||| .||...|...::..::
  Rat   304 EGLP---NFD--------NNNIK--GSLIITFDVDFPKEQLTEEAKEGIKQLLKQ 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 99/380 (26%)
DnaJ 7..87 CDD:278647 24/79 (30%)
DnaJ_C 156..335 CDD:199909 57/212 (27%)
Dnajb11NP_001015021.1 DnaJ 22..344 CDD:223560 99/377 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.