DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and DNAJB1

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_006136.1 Gene:DNAJB1 / 3337 HGNCID:5270 Length:340 Species:Homo sapiens


Alignment Length:368 Identity:115/368 - (31%)
Similarity:164/368 - (44%) Gaps:88/368 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKD--EQDFVPLAQEGRLTHLSPMGEPRQWAY 69
            |||..|...|||:.|:|..||||.|:|..|.::|:.  |:.|..:|:                  
Human     4 DYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAE------------------ 50

  Fly    70 VNMAFDVLGNDLYRAIYDRFGEAGL---------FEGVMLPNGYFPPYQYDGDHMKVYERVFGSY 125
               |:|||.:...|.|:||:||.||         ..|.   ||....|.:.||...::...||..
Human    51 ---AYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGA---NGTSFSYTFHGDPHAMFAEFFGGR 109

  Fly   126 SPY------------ANVIDAISNPPSLYATRQHGIG----------------VRSK-DASTERI 161
            :|:            .::.|..|..|.       |:|                .|.| |......
Human   110 NPFDTFFGQRNGEEGMDIDDPFSGFPM-------GMGGFTNVNFGRSRSAQEPARKKQDPPVTHD 167

  Fly   162 IELSLEEVRTGCVKLMNVWRQEI-VDAKESRLEKRKHTLKLNIAPGTTAGTRFCFKEEGDRYPAT 225
            :.:||||:.:||.|.|.:..:.: .|.|..|.|.:  .|.:.:..|...||:..|.:|||:....
Human   168 LRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDK--ILTIEVKKGWKEGTKITFPKEGDQTSNN 230

  Fly   226 IPGDIIFIAADKPHPDFERRNQHDLVYRQSIGLCQAFTGFTFFICTLDRRQLKVVITDVVQPGYT 290
            ||.||:|:..||||..| :|:..|::|...|.|.:|..|.|..:.|||.|.:.||..||::||..
Human   231 IPADIVFVLKDKPHNIF-KRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMR 294

  Fly   291 KVVPLEGLPKCRNLDAVTAIKEANKKVEQFGDLIIEFDYIFPK 333
            :.||.||||             ..|..|:.|||||||:.|||:
Human   295 RKVPGEGLP-------------LPKTPEKRGDLIIEFEVIFPE 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 115/368 (31%)
DnaJ 7..87 CDD:278647 26/81 (32%)
DnaJ_C 156..335 CDD:199909 66/179 (37%)
DNAJB1NP_006136.1 DnaJ 1..340 CDD:223560 115/368 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 1 1.010 - - D1393097at2759
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.