DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and shv

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster


Alignment Length:380 Identity:99/380 - (26%)
Similarity:140/380 - (36%) Gaps:96/380 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPRQWAYVN 71
            |:|.:|:..:.|...::..||||||..|.|.::|.|     |.|.    |....:|         
  Fly    25 DFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDD-----PDAS----TKFQDLG--------- 71

  Fly    72 MAFDVLGNDLYRAIYDRFGEAGLFEGVMLPNGYFPPYQYDGDH--------------------MK 116
            .|::||.|...|..|||.||..|.:..|:.:|..|...:.||.                    |.
  Fly    72 AAYEVLSNPDKRKTYDRCGEECLKKEGMMDHGGDPFSSFFGDFGFHFGGDGQQQDAPRGADIVMD 136

  Fly   117 VYERVFGSYSPYANVIDAISNPPSLYATRQHGIGVRSKDASTERIIELSLEEV------------ 169
            :|..:...||  .|.::.:.|.|.            :|.||..|......|.|            
  Fly   137 LYVSLEELYS--GNFVEIVRNKPV------------TKPASGTRKCNCRQEMVTRNLGPGRFQMI 187

  Fly   170 -RTGCVKLMNVWRQEIVDAKESRLEKRKHTLKLNIAPGTTAGTRFCFKEEGDRYPATIPGDIIFI 233
             :|.|.:..||           :|...:.||::.:..|...|....|..||:.:....|||:|..
  Fly   188 QQTVCDECPNV-----------KLVNEERTLEIEVEQGMVDGQETRFVAEGEPHIDGEPGDLIVR 241

  Fly   234 AADKPHPDFERRNQHDLVYRQSIGLCQAFTGFTFFICTLDRRQLKVVITDVVQPGYTKVVPLEGL 298
            ....|||.|.|:|. ||....:|.|..|..||:..|..||...:.|....|..||.......||:
  Fly   242 VQQMPHPRFLRKND-DLYTNVTISLQDALVGFSMEIKHLDGHLVPVTREKVTWPGARIRKKGEGM 305

  Fly   299 PKCRNLDAVTAIKEANKKVEQFGDLIIEFDYIFPKYLTPHMKHITREFFREFRKL 353
            |...|.:..             |:|.|.||..|||      |.:|.|.....:|:
  Fly   306 PNFENNNLT-------------GNLYITFDVEFPK------KDLTEEDKEALKKI 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 98/377 (26%)
DnaJ 7..87 CDD:278647 23/79 (29%)
DnaJ_C 156..335 CDD:199909 53/191 (28%)
shvNP_608525.1 DnaJ 22..346 CDD:223560 99/380 (26%)
DnaJ 25..87 CDD:278647 23/79 (29%)
DnaJ_C 131..328 CDD:199909 61/241 (25%)
DnaJ_zf 160..>195 CDD:304418 8/34 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458970
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.