DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and DNAJB2

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_006727.2 Gene:DNAJB2 / 3300 HGNCID:5228 Length:324 Species:Homo sapiens


Alignment Length:138 Identity:40/138 - (28%)
Similarity:58/138 - (42%) Gaps:35/138 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKK-DEQDFVPLAQEGRLTHLSPMGEPRQWAYVN 71
            ||.:||.||.|:.:.|..||||.|::.  |.||. |.::|.                .:::..|.
Human     4 YYEILDVPRSASADDIKKAYRRKALQW--HPDKNPDNKEFA----------------EKKFKEVA 50

  Fly    72 MAFDVLGNDLYRAIYDRFGEAGLFEGVMLPNGYFPPYQYDG-----------DHMKVYERVFGSY 125
            .|::||.:...|.||||:|..||     ...|..|.....|           ...:|:...|||.
Human    51 EAYEVLSDKHKREIYDRYGREGL-----TGTGTGPSRAEAGSGGPGFTFTFRSPEEVFREFFGSG 110

  Fly   126 SPYANVID 133
            .|:|.:.|
Human   111 DPFAELFD 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 40/138 (29%)
DnaJ 7..87 CDD:278647 24/79 (30%)
DnaJ_C 156..335 CDD:199909
DNAJB2NP_006727.2 DnaJ 3..>110 CDD:223560 36/128 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..90 5/24 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..324
CAAX motif. /evidence=ECO:0000269|PubMed:12754272 321..324
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.