DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and dnajb1b

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_956067.1 Gene:dnajb1b / 327244 ZFINID:ZDB-GENE-030131-5455 Length:337 Species:Danio rerio


Alignment Length:365 Identity:108/365 - (29%)
Similarity:173/365 - (47%) Gaps:72/365 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKK--DEQDFVPLAQEGRLTHLSPMGEPRQWAY 69
            |||:||...:||:.::|..|||:.|::..|.::|.  .|:.|..:|:                  
Zfish     4 DYYSVLGIQKGASDDEIKKAYRKQALKYHPDKNKSAGAEEKFKEIAE------------------ 50

  Fly    70 VNMAFDVLGNDLYRAIYDRFGEAGLFEGVMLPNG------YFPPYQYDGDHMKVYERVFGSYSPY 128
               |:|||.:...:.|||||||.||..|.  |.|      |  .|.:.||...::...||..:|:
Zfish    51 ---AYDVLSDPKKKDIYDRFGEEGLKGGA--PGGGGGGGNY--TYTFQGDPHAMFSEFFGGRNPF 108

  Fly   129 ANV---------------------IDAISNPPSLYATRQHGIGV-RSKDASTERIIELSLEEVRT 171
            .::                     :..|...|..:.|..||..: |.:|.:....:.:||:||.|
Zfish   109 EHIFGHNGGMDENMETDDLFASFGMGGIGGFPRSFTTHSHGGRMERKQDPAVIHDLRVSLDEVFT 173

  Fly   172 GCVKLMNVWRQEI-VDAKESRLEKRKHTLKLNIAPGTTAGTRFCFKEEGDRYPATIPGDIIFIAA 235
            ||.|.|.:.|:.: .|.:.:|.|.:  .|.:.:..|...||:..|..|||..|:.||.|::|:..
Zfish   174 GCTKKMKISRKRLNPDGRTTRSEDK--ILTVEVKKGWKEGTKITFPREGDETPSNIPADVVFVLK 236

  Fly   236 DKPHPDFERRNQHDLVYRQSIGLCQAFTGFTFFICTLDRRQLKVVITDVVQPGYTKVVPLEGLPK 300
            |||||.: :|:..|::|...|.|.:|..|....:.|||.|.:||...|:|:||..:.:..|||| 
Zfish   237 DKPHPVY-KRDGSDIIYPAKITLKEALCGCVINVPTLDGRTVKVTSQDIVRPGMKRRLTGEGLP- 299

  Fly   301 CRNLDAVTAIKEANKKVEQFGDLIIEFDYIFPKYLTPHMK 340
                        ..|..::.|||::|::..||:.|:.:.|
Zfish   300 ------------LPKSPDRRGDLVVEYEVRFPEKLSQNAK 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 108/365 (30%)
DnaJ 7..87 CDD:278647 22/81 (27%)
DnaJ_C 156..335 CDD:199909 59/179 (33%)
dnajb1bNP_956067.1 DnaJ 1..328 CDD:223560 108/365 (30%)
DnaJ 4..65 CDD:278647 22/81 (27%)
DnaJ_C 160..322 CDD:199909 59/177 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 1 1.010 - - D1393097at2759
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.