Sequence 1: | NP_647662.1 | Gene: | CG12020 / 38233 | FlyBaseID: | FBgn0035273 | Length: | 366 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_997824.1 | Gene: | dnajb12a / 324005 | ZFINID: | ZDB-GENE-030131-2725 | Length: | 371 | Species: | Danio rerio |
Alignment Length: | 268 | Identity: | 55/268 - (20%) |
---|---|---|---|
Similarity: | 88/268 - (32%) | Gaps: | 112/268 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 DYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPRQWAYVN 71
Fly 72 MAFDVLGNDLYRAIYDRFGEAGL------------FEGVMLP--------NGYFPP---YQYDG- 112
Fly 113 ----DHMKVYER-----------------------------VFGSYSPYANVIDAISNPPSL--- 141
Fly 142 -----------YATRQH------GIGVRSKDASTERIIELSLEEVRTGCVKLMNVWRQEIVDAKE 189
Fly 190 SRLEKRKH 197 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12020 | NP_647662.1 | DnaJ | 7..352 | CDD:223560 | 55/268 (21%) |
DnaJ | 7..87 | CDD:278647 | 22/79 (28%) | ||
DnaJ_C | 156..335 | CDD:199909 | 9/42 (21%) | ||
dnajb12a | NP_997824.1 | DnaJ | 107..>211 | CDD:223560 | 32/121 (26%) |
DnaJ | 108..169 | CDD:278647 | 22/79 (28%) | ||
DUF1977 | 263..363 | CDD:286411 | 19/94 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |