DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and dnajb12a

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_997824.1 Gene:dnajb12a / 324005 ZFINID:ZDB-GENE-030131-2725 Length:371 Species:Danio rerio


Alignment Length:268 Identity:55/268 - (20%)
Similarity:88/268 - (32%) Gaps:112/268 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPRQWAYVN 71
            |||..|...:.|::|.:..|||:||::.  |.||    :..|.|.|.             :..:.
Zfish   108 DYYETLGVSKEASEEDLKKAYRKLALKF--HPDK----NHAPGATEA-------------FKAIG 153

  Fly    72 MAFDVLGNDLYRAIYDRFGEAGL------------FEGVMLP--------NGYFPP---YQYDG- 112
            .|:.||.|...|..||.:||...            ||..:.|        .|.||.   :.|.. 
Zfish   154 NAYAVLSNPEKRRQYDVYGEEKAHPTHRHRTYHRNFEADISPEDLFNMFFGGGFPTSNVHVYSNG 218

  Fly   113 ----DHMKVYER-----------------------------VFGSYSPYANVIDAISNPPSL--- 141
                .|.:.:||                             :..|..||     ::|:.|||   
Zfish   219 RMRFGHQQRHERQEQQREGGLALFVQLMPILILIIVSALSQMMVSSPPY-----SLSHRPSLGHT 278

  Fly   142 -----------YATRQH------GIGVRSKDASTERIIELSLEEVRTGCVKLMNVWRQEIVDAKE 189
                       |....|      |:.:::.:.|.|   |..:..:|..|      |:::  ..||
Zfish   279 SRRQTATLKVPYYVGDHFSEEYKGMNLKNVEQSVE---EDYISNLRNNC------WKEK--QQKE 332

  Fly   190 SRLEKRKH 197
            ..|.:.::
Zfish   333 GLLYRARY 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 55/268 (21%)
DnaJ 7..87 CDD:278647 22/79 (28%)
DnaJ_C 156..335 CDD:199909 9/42 (21%)
dnajb12aNP_997824.1 DnaJ 107..>211 CDD:223560 32/121 (26%)
DnaJ 108..169 CDD:278647 22/79 (28%)
DUF1977 263..363 CDD:286411 19/94 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.