DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and Dnajb13

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001005885.1 Gene:Dnajb13 / 308857 RGDID:1359131 Length:316 Species:Rattus norvegicus


Alignment Length:344 Identity:127/344 - (36%)
Similarity:175/344 - (50%) Gaps:38/344 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LDYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPRQWAYV 70
            :||||||...|.:...||..|||:||::  .|..|.:|    |.|             |..:..:
  Rat     3 MDYYAVLQVNRNSEDAQIKKAYRKLALK--NHPLKSNE----PTA-------------PEIFRQI 48

  Fly    71 NMAFDVLGNDLYRAIYDRFGEAGLFEGVMLPNGYFPP----YQYDGDHMKVYERVFGSYSPYANV 131
            ..|:|||.:.:.|.|||:|||.||..|:.|..|...|    |.:.|:..||:...||..:|::..
  Rat    49 AEAYDVLSDPVKRGIYDKFGEEGLKGGIPLEFGSQTPWTTGYVFHGNPEKVFHEFFGGDNPFSEF 113

  Fly   132 IDAISNPPSLYATRQHGIGVRSKDASTERIIELSLEEVRTGCVKLMNVWRQEIVDAKESRLEKRK 196
            .||..|...|......|.||:.:|...||.:.||||::..||.|.:.:.|:.:.:...|...|.|
  Rat   114 FDAEGNDIDLNFGGLRGRGVQKQDPPIERDLYLSLEDLFFGCTKKIKISRRVLNEDGYSSTIKDK 178

  Fly   197 HTLKLNIAPGTTAGTRFCFKEEGDRYPATIPGDIIFIAADKPHPDFERRNQHDLVYRQSIGLCQA 261
             .|.:::.||...|||..|::|||:.|..||.|||||..:|.||.| ||.|.:|.:...|.|.:|
  Rat   179 -ILTIDVRPGWRQGTRITFEKEGDQGPNIIPADIIFIVKEKLHPRF-RREQDNLFFVYPIPLGKA 241

  Fly   262 FTGFTFFICTLDRRQLKVVITDVVQPGYTKVVPLEGLPKCRNLDAVTAIKEANKKVEQFGDLIIE 326
            .|..|..:.|||.|.|.:.|.|:|.|.|.|:||.||:|         ..::..||    |||.|.
  Rat   242 LTCCTVEVKTLDDRLLNIPINDIVHPKYFKMVPGEGMP---------LPEDPTKK----GDLFIF 293

  Fly   327 FDYIFPKYLTPHMKHITRE 345
            ||..||..|||..|.:.|:
  Rat   294 FDIQFPTRLTPQKKQMLRQ 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 127/343 (37%)
DnaJ 7..87 CDD:278647 26/79 (33%)
DnaJ_C 156..335 CDD:199909 70/178 (39%)
Dnajb13NP_001005885.1 DnaJ 1..312 CDD:223560 126/342 (37%)
DnaJ 4..65 CDD:278647 26/79 (33%)
DnaJ_C 138..302 CDD:199909 70/178 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343767
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 1 1.010 - - D1393097at2759
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24078
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.