DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12020 and Dnaja4

DIOPT Version :9

Sequence 1:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001020582.1 Gene:Dnaja4 / 300721 RGDID:1310035 Length:555 Species:Rattus norvegicus


Alignment Length:417 Identity:102/417 - (24%)
Similarity:168/417 - (40%) Gaps:116/417 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ELDYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPRQWAY 69
            |..||.:|.....|:.|:|..|||:||::.  |.||..::                 ||  ::..
  Rat   162 ETQYYDILGVKPSASPEEIKKAYRKLALKY--HPDKNPDE-----------------GE--KFKL 205

  Fly    70 VNMAFDVLGNDLYRAIYDRFGEAGLFEGVMLPNGYFPPYQYDGDHMKVYERVFGSYSPYA----- 129
            ::.|::||.:...|.|||:.||..:.||......:..|       |.:::..||......     
  Rat   206 ISQAYEVLSDPKKRDIYDQGGEQAIKEGGSGSPSFSSP-------MDIFDMFFGGGGRMTRERRG 263

  Fly   130 -NVIDAIS-NPPSLYATRQHGI----------------GVRSKDASTE-------RIIELSLEEV 169
             ||:..:| ....||    :||                |:..|..|.|       |.:::.::::
  Rat   264 KNVVHQLSVTLEDLY----NGITKKLALQKNIICEKCEGIGGKKGSVEKCPLCKGRGMQIHIQQI 324

  Fly   170 RTGCVKLMNVW-------------RQEIVDAKESRLEKRKHTLKLNIAPGTTAGTRFCFKEEGDR 221
            ..|.|:.:...             :....|...:::.:.|..:::::..|...|.:..|..|||:
  Rat   325 GPGMVQQIQTVCIECKGQGERINPKDRCEDCSGAKVTREKKIIEVHVDKGMKDGQKILFHGEGDQ 389

  Fly   222 YPATIPGDIIFIAADKPHPDFERRNQHDLVYRQSIGLCQAFTGFTFFICTLDRRQLKVVIT---- 282
            .|...|||:|.:...|.|..|:||. |||:.:..|.|.:|..||...|.|||.|.|  :|:    
  Rat   390 EPELEPGDVIIVLDQKDHSVFQRRG-HDLIMKMKIQLSEALCGFKKTIKTLDDRVL--IISSKSG 451

  Fly   283 DVVQPGYTKVVPLEGLPKCRNLDAVTAIKEANKKVEQFGDLIIEFDYIFPK-------------- 333
            :|::.|..|.|..||:|             ..|...:.|.|||:|..:||:              
  Rat   452 EVIKHGDLKCVRNEGMP-------------IYKAPLEKGMLIIQFLVVFPEKQWLSLEKLPQLEA 503

  Fly   334 YLTPHMK-HITREFFREFRKLEIELEE 359
            .|.|..| .||.:..      ::||:|
  Rat   504 LLPPRQKVRITDDMD------QVELKE 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 98/406 (24%)
DnaJ 7..87 CDD:278647 21/79 (27%)
DnaJ_C 156..335 CDD:199909 53/216 (25%)
Dnaja4NP_001020582.1 PTZ00037 144..552 CDD:240236 102/417 (24%)
DnaJ 165..223 CDD:278647 21/78 (27%)
DnaJ_C 264..490 CDD:199909 62/245 (25%)
DnaJ_zf 293..359 CDD:199908 8/65 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.880

Return to query results.
Submit another query.